[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36881.1
DDBJ      :             chromate transport protein, putative
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  102/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:166 amino acids
:PSIPRED
:RPS:SCOP  30->73 2i9uA2  c.1.9.9 * 5e-04 22.5 %
:RPS:PFM   1->97 PF02417 * Chromate_transp 4e-14 45.4 %
:HMM:PFM   2->162 PF02417 * Chromate_transp 4.8e-36 32.9 161/169  
:BLT:SWISS 3->88 SRPC_SYNE7 7e-13 38.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36881.1 GT:GENE AAD36881.1 GT:PRODUCT chromate transport protein, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1795025..1795525) GB:FROM 1795025 GB:TO 1795525 GB:DIRECTION - GB:PRODUCT chromate transport protein, putative GB:NOTE similar to GB:AE000783 percent identity: 61.07; identified by sequence similarity; putative GB:PROTEIN_ID AAD36881.1 GB:DB_XREF GI:4982400 LENGTH 166 SQ:AASEQ MLKLAFIFLKIGFLSFGGGWAIVGILKNELVTGGFLSPEEFSQAVSIAQMTPGPVAINLATYTGYKFFGLIGAVLNTLAFLGAPILVITTAIFLRKYVKLQRVRLMKALEGATTTLLIVTLLSLLSSVQNPVLILLSAAAFVCSFFKVHPLFIIFGCGVIGAILGF GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 3->88|SRPC_SYNE7|7e-13|38.4|86/393| TM:NTM 4 TM:REGION 8->30| TM:REGION 68->90| TM:REGION 114->136| TM:REGION 143->165| SEG 113->128|tttllivtllsllssv| RP:PFM:NREP 1 RP:PFM:REP 1->97|PF02417|4e-14|45.4|97/170|Chromate_transp| HM:PFM:NREP 1 HM:PFM:REP 2->162|PF02417|4.8e-36|32.9|161/169|Chromate_transp| GO:PFM:NREP 2 GO:PFM GO:0015109|"GO:chromate transmembrane transporter activity"|PF02417|IPR003370| GO:PFM GO:0015703|"GO:chromate transport"|PF02417|IPR003370| RP:SCP:NREP 1 RP:SCP:REP 30->73|2i9uA2|5e-04|22.5|40/310|c.1.9.9| OP:NHOMO 151 OP:NHOMOORG 104 OP:PATTERN --1----------------------------------------------------------------- ----------------------------------------------------------------------------------1-----114112-1-----2----1--1------------------------------------11--111-1-1------11-1--111---1-1----------11----------1------------------11-2---------2-------------------------------------------------------------------------------------------25--2222222222-3--111122-31-32--11----21--22--211-------------------------------------------------------------------------111--------------------------------------------------------1----1--111---11111-1-5-----------------11---------1------------------------------1-11-------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------1--------------2-1-------------------------2-31121222--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc //