[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36908.1
DDBJ      :             beta transducin-related protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  70/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
b.69.4
:580 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->212 1p22A PDBj 4e-11 24.7 %
:BLT:PDB   223->509 2ovrB PDBj 3e-17 24.4 %
:RPS:PDB   30->576 3ei3A PDBj 3e-38 9.2 %
:RPS:SCOP  32->292 1pguA2  b.69.4.1 * 3e-22 20.7 %
:RPS:SCOP  269->549 1u4cA  b.69.4.2 * 8e-31 27.1 %
:HMM:SCOP  29->292 1p22A2 b.69.4.1 * 6.8e-48 26.4 %
:HMM:SCOP  162->433 1erjA_ b.69.4.1 * 8.5e-47 22.1 %
:HMM:SCOP  302->581 1sq9A_ b.69.4.1 * 5e-40 25.7 %
:RPS:PFM   297->333 PF00400 * WD40 4e-04 44.7 %
:RPS:PFM   469->499 PF00400 * WD40 1e-04 54.8 %
:HMM:PFM   61->91 PF00400 * WD40 0.00015 29.0 31/39  
:HMM:PFM   101->132 PF00400 * WD40 1.4e-09 43.8 32/39  
:HMM:PFM   181->212 PF00400 * WD40 1.4e-07 31.2 32/39  
:HMM:PFM   257->292 PF00400 * WD40 2.8e-05 22.2 36/39  
:HMM:PFM   297->333 PF00400 * WD40 4.3e-10 37.8 37/39  
:HMM:PFM   466->499 PF00400 * WD40 6.4e-10 38.2 34/39  
:BLT:SWISS 32->509 YY46_ANASP 3e-31 26.4 %
:BLT:SWISS 482->577 WDHD1_XENLA 6e-04 23.5 %
:PROS 320->334|PS00678|WD_REPEATS_1
:PROS 486->500|PS00678|WD_REPEATS_1
:TM
:REPEAT 4|54->132|133->212|253->333|411->499
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36908.1 GT:GENE AAD36908.1 GT:PRODUCT beta transducin-related protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1825249..1826991 GB:FROM 1825249 GB:TO 1826991 GB:DIRECTION + GB:PRODUCT beta transducin-related protein GB:NOTE similar to PID:607003 percent identity: 49.46; identified by sequence similarity; putative GB:PROTEIN_ID AAD36908.1 GB:DB_XREF GI:4982430 LENGTH 580 SQ:AASEQ MKKSLTLVLVVVSILIFSQTFKLEKVLGFSDISSLAFKDGYLLLGTGNGEIIVYKDGSYYRAFKVHDNRVNEVTFENGFIVSASDDKTVGVTNLETGEIKLLKGHMKGVSSVAVAGSKILSASFDGTVRVWSFPDGGEISSQKLGPSVVQIAAHENRYVVGLANGLALIRDLSNQSFSIPLKAHPEGIKKIVFSENGQLIATCGGNTVKVWNASNGNLVLQYDHVITVNDVAFLENDSLIFVADDYKAVVLNIQKNEVVKSIDAHNNFVLFVSSDDGSIATYGMDKTVKVWNANLELQYSLYGHQLSVNTVALSSDRKFIVSGSDDREILIWNTEKGIAEHRIKALSGVRKLLTVENNIISCLDSNQLKIYNLENGKLVKRIKVGTTSTMDIALQNDRMAVGFYDGSVALFRYPSFEEIWRKDTEHEMIQTIDMNNKFIAFGVSYSDPKDKIGYVEVLSADTGERVFLLEGHRGNVNAVKFAGDFLVSGGEDGKVILWNLDTGSKVKEIYLNEPVSSLFVDEKELFVGTWNGSIKIFAFPDLTLKTSLKASDQKIGHLIKVGNHLVVPCGDGKIRILVEK GT:EXON 1|1-580:0| BL:SWS:NREP 2 BL:SWS:REP 32->509|YY46_ANASP|3e-31|26.4|470/1526| BL:SWS:REP 482->577|WDHD1_XENLA|6e-04|23.5|96/1127| PROS 320->334|PS00678|WD_REPEATS_1|PDOC00574| PROS 486->500|PS00678|WD_REPEATS_1|PDOC00574| TM:NTM 1 TM:REGION 4->26| NREPEAT 1 REPEAT 4|54->132|133->212|253->333|411->499| SEG 4->16|sltlvlvvvsili| BL:PDB:NREP 2 BL:PDB:REP 35->212|1p22A|4e-11|24.7|177/402| BL:PDB:REP 223->509|2ovrB|3e-17|24.4|275/442| RP:PDB:NREP 1 RP:PDB:REP 30->576|3ei3A|3e-38|9.2|542/1105| RP:PFM:NREP 2 RP:PFM:REP 297->333|PF00400|4e-04|44.7|37/39|WD40| RP:PFM:REP 469->499|PF00400|1e-04|54.8|31/39|WD40| HM:PFM:NREP 6 HM:PFM:REP 61->91|PF00400|0.00015|29.0|31/39|WD40| HM:PFM:REP 101->132|PF00400|1.4e-09|43.8|32/39|WD40| HM:PFM:REP 181->212|PF00400|1.4e-07|31.2|32/39|WD40| HM:PFM:REP 257->292|PF00400|2.8e-05|22.2|36/39|WD40| HM:PFM:REP 297->333|PF00400|4.3e-10|37.8|37/39|WD40| HM:PFM:REP 466->499|PF00400|6.4e-10|38.2|34/39|WD40| RP:SCP:NREP 2 RP:SCP:REP 32->292|1pguA2|3e-22|20.7|251/281|b.69.4.1| RP:SCP:REP 269->549|1u4cA|8e-31|27.1|258/322|b.69.4.2| HM:SCP:REP 29->292|1p22A2|6.8e-48|26.4|258/0|b.69.4.1|1/2|WD40 repeat-like| HM:SCP:REP 162->433|1erjA_|8.5e-47|22.1|271/0|b.69.4.1|2/3|WD40 repeat-like| HM:SCP:REP 302->581|1sq9A_|5e-40|25.7|272/0|b.69.4.1|2/2|WD40 repeat-like| OP:NHOMO 2665 OP:NHOMOORG 268 OP:PATTERN --------------------------------------------------22---------------- --1-1----------------1--1------------1---212--------------------1----11----------------------------------1-1-----------------2111211116143315---1-ZAG767A-----------21CQMTJ-------------1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------1-----------------------------------1-------------------------------------------------------------------------1------------4------------------1-------------------1--------28------------------------11----------------------1--1-1--1---------------------------------------------------------11------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------21---1-111--- 4324MTB-D68-FJI6685EBB8ABGB879766A9697675687777GAR73DE434E8768A637A534865736725663453399-GPL6IJ*988676AQPR3F7BcGHHIGI76748H9UL1Q5Z*P2YMZ7776G99GAA9744F53P7ICHOFDECGIA4DHDTDDOQ1876*45443B8HEAD8416C78I ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 561 STR:RPRED 96.7 SQ:SECSTR #################HHHEEEEEccccccccEEEEccEEEEETTEEEEEEEEEEEEEEEEEccccEEEEEcccccEEEEEETTTTEEEEEETTTccEEEEEccccccEEEEEEEEEEEEEETTcEEEEEEEcTTTccEEEEEEEEccccccEEEEEEEEccccEEEEEccccEEEEEcccccccEEEEEcccccTTEEEEEccccEEEEEEcccccEEEEEEEcccEEEEEEEEGGGTEEEEEEEEEEEEcccccEEEccccHHHHccEEcccccccccEEEEEEEEEEETTEEEEccTTEEEEEEEEEccTTccccEEEEEEEEccTTccccccEEEEEEEEETTcEEEEEEETTEEEEEETTEEEEEEEcTTccEEEEEEEcccccEEEEEEEEEEEEEccccEEEEEEETTTTEEEEEEEEccccccEEEEEEEETTEEEEEETTcEEEEEEEcTTcccTTGGccEEEEEEccccccEEEEEEEETTccEEEEEEEcHHHHHHHHHHHHHHHHcccccHHHHHcEEccccEEccccEEEHHHHTcEEHGGGGccHHHHHHHccccccHHHHEE## DISOP:02AL 580-581| PSIPRED ccEEEEEEEEEEEEEEEccccEEEEEEccccEEEEEEcccEEEEEEccccEEEEEccEEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEEcccEEEEEEcccEEEEEEcccccEEEEEEccccEEEEcccccEEEEEEcccEEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEcccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEEccccEEEEEEccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEccccEEEEEEEcccccEEEEEEcccEEEEEEEEcccccEEEEEEEEEccccEEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccccEEEEEEccccEEEEEEcccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccEEEEEEccccEEEEEEc //