[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36909.1
DDBJ      :             ROK family protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   72->200 1z05A PDBj 2e-08 28.9 %
:RPS:PDB   67->257 3bp8A PDBj 7e-23 19.5 %
:RPS:SCOP  15->49 1woqA1  c.55.1.10 * 3e-05 14.7 %
:RPS:SCOP  75->232 2aa4A2  c.55.1.10 * 4e-24 25.0 %
:HMM:SCOP  15->70 2hoeA3 c.55.1.10 * 2.1e-09 45.5 %
:HMM:SCOP  75->242 1z05A2 c.55.1.10 * 2.7e-30 32.7 %
:RPS:PFM   15->133 PF00480 * ROK 4e-07 29.9 %
:HMM:PFM   11->133 PF00480 * ROK 2.9e-32 43.0 121/179  
:BLT:SWISS 5->223 XYLR2_BACSU 6e-16 34.1 %
:PROS 84->111|PS01125|ROK
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36909.1 GT:GENE AAD36909.1 GT:PRODUCT ROK family protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1827011..1827787) GB:FROM 1827011 GB:TO 1827787 GB:DIRECTION - GB:PRODUCT ROK family protein GB:NOTE similar to GB:M27248 SP:P16557 PID:143841 PID:580652 PID:1750123 percent identity: 52.86; identified by sequence similarity; putative GB:PROTEIN_ID AAD36909.1 GB:DB_XREF GI:4982431 LENGTH 258 SQ:AASEQ MTEKVSRFPGVFPLIVIGVPGSVDKTHKKLAFAPNLNRWRDIDVEKYFKVFEVYLENDANLAALAEMMRNKHFGDRKNIVYILVREGIGGGIIIEGKLYKGSFNAAGEIGHMKMYDRGPCFCGRVGCWEANTSISHCVRQYEKKKPLPGNTMYEKFETLCRIYEEDPLAKEVLDEFTGILIDGIVNLVNILSPEIVIVGGEGVFLPESVFEVIVSETRRQVHPMDKEVSVEKGSLSNKEVVLEGTSILSSMMISERLV GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 5->223|XYLR2_BACSU|6e-16|34.1|211/384| PROS 84->111|PS01125|ROK|PDOC00866| SEG 55->66|lendanlaalae| SEG 86->96|egigggiiieg| BL:PDB:NREP 1 BL:PDB:REP 72->200|1z05A|2e-08|28.9|128/396| RP:PDB:NREP 1 RP:PDB:REP 67->257|3bp8A|7e-23|19.5|190/381| RP:PFM:NREP 1 RP:PFM:REP 15->133|PF00480|4e-07|29.9|117/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 11->133|PF00480|2.9e-32|43.0|121/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 15->49|1woqA1|3e-05|14.7|34/129|c.55.1.10| RP:SCP:REP 75->232|2aa4A2|4e-24|25.0|152/170|c.55.1.10| HM:SCP:REP 15->70|2hoeA3|2.1e-09|45.5|55/0|c.55.1.10|1/1|Actin-like ATPase domain| HM:SCP:REP 75->242|1z05A2|2.7e-30|32.7|168/0|c.55.1.10|1/1|Actin-like ATPase domain| OP:NHOMO 75 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------111---- --1------------------------------------------------------1---------111--------------------1---------1-----------------------1------------------1--------------------------------------------22---1------11--------1--1------1-1--------13------------------------------------------------------------------------------------------11-12-------1-111------1-1-------------3--14421----------------------------------------------------1-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------2121122222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 99.2 SQ:SECSTR ##HHHTTTGGGccEEEEEEccEEETTEEEcccGGGGGGGTTccHHHHHHHHcccEEEEEHHHHHHHHHHccTTTTcccEEEEEEcccEEEEEEETTEEccccccccccGGGcccccccccccccccccTTTccHHHHHHHHHTTTTTccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHHHHccHHHHTccEEEccccTcTcGGGGHHHHHHHHHccTTH DISOP:02AL 258-259| PSIPRED cHHHHHHccccEEEEEEEcccEEEccccEEEEcccccccccccHHHHHHcccEEEEEcHHHHHHHHHHccccccccccEEEEEEcccEEEEEEEccEEEEcccccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHccHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHccccc //