[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36916.1
DDBJ      :             sugar ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  572/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:290 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->237 3fh6F PDBj 3e-15 30.3 %
:RPS:PDB   180->217 3dhwA PDBj 7e-09 31.6 %
:RPS:SCOP  40->285 2r6gG1  f.58.1.1 * 8e-20 16.9 %
:RPS:PFM   152->272 PF00528 * BPD_transp_1 2e-09 33.6 %
:HMM:PFM   65->280 PF00528 * BPD_transp_1 4.5e-21 22.8 162/185  
:BLT:SWISS 2->273 LACF_RHIRD 5e-41 38.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36916.1 GT:GENE AAD36916.1 GT:PRODUCT sugar ABC transporter, permease protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1836728..1837600) GB:FROM 1836728 GB:TO 1837600 GB:DIRECTION - GB:PRODUCT sugar ABC transporter, permease protein GB:NOTE similar to PID:1652461 percent identity: 60.89; identified by sequence similarity; putative GB:PROTEIN_ID AAD36916.1 GB:DB_XREF GI:4982438 LENGTH 290 SQ:AASEQ MSLKRREARLGWGLVSIYLLYTAIFWGYPFVWMLILAFSRWKFVGSPKFVGLQNFFRIFEDKIFWRVFLNTMNFLSYFIPMVFIASILFAIALNRMKYFKTFVTLSFLVAYVSSGVAYSIMFQRIFSETGPINRFLYNAFGITIPWFTDPQLAMLTIAIMVTWKFVGYYGLILYSGLQAIPKSIFEAAELDGATSWVKFWKITLPLLNPAIVTVLILAVNLSFGIFTEPYMITGGGPMNRTLTFMLYMYNTAFQRINPSYATTIAIMTALINFSIVIFIRKVIEKEVTVV GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 2->273|LACF_RHIRD|5e-41|38.7|269/298| TM:NTM 6 TM:REGION 19->40| TM:REGION 69->91| TM:REGION 99->121| TM:REGION 154->176| TM:REGION 202->224| TM:REGION 259->280| BL:PDB:NREP 1 BL:PDB:REP 24->237|3fh6F|3e-15|30.3|208/316| RP:PDB:NREP 1 RP:PDB:REP 180->217|3dhwA|7e-09|31.6|38/203| RP:PFM:NREP 1 RP:PFM:REP 152->272|PF00528|2e-09|33.6|116/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 65->280|PF00528|4.5e-21|22.8|162/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 40->285|2r6gG1|8e-20|16.9|231/284|f.58.1.1| OP:NHOMO 3437 OP:NHOMOORG 611 OP:PATTERN 22--4111453444526-2321--71151-3-----------------------2453111522---- ---1j213335-1123344-433348444444244414575336M*b2EHG4QJP129--968AI4DNYI69555HDA1---3-------------------------1---------------------------79978---77221311-112222122222213331-2-----2----EE265EH-953333233442243334VHAA4833454C2945789788A*211111111111111-1---641134--22233--33---1-53453436555422777888877775444455554444455---5555G4-3B1111121514E3--1445j-37324G--231--1K--1996I3-1-------111112-EBB1--535536766677777F---6--4-19P--ZVVJdZRqnfVR23---BGA8569D85--------4112--12-----------------------------2---2-1433378988751333558A4443337562223--2237-23343678C-1--1--3--------------1-2--11---11111---------221224----------1------------------125-----1-6----------------------1---------26981513333333333-33333334333323333325657611123222222222222226-213333--599999999999---------11111-86E111111-----1--1------------22222334432233334-----------222222224154422111111111111---1---------------1821121-11-121-111----42---7OGC9CTAEB-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------1--1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 72.4 SQ:SECSTR #######################HHTHHHHHHHHTTccccccccccccHHHHHTTHHHHcccHHHHHHHHHHHHHHHHHHHH#HHHHHTccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccH###HHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcHHHHHHHccccc##################################################### DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHEEccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEc //