[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36921.1
DDBJ      :             DNA repair protein
Swiss-Prot:RECA_THESQ   RecName: Full=Protein recA;AltName: Full=Recombinase A;

Homologs  Archaea  10/68 : Bacteria  894/915 : Eukaryota  17/199 : Viruses  3/175   --->[See Alignment]
c.37.1d.48.1
:356 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   7->319 1ubgA PDBj 2e-94 59.6 %
:RPS:PDB   4->295 3cmxA PDBj 7e-58 57.7 %
:RPS:SCOP  3->270 1g18A1  c.37.1.11 * 1e-42 62.1 %
:RPS:SCOP  272->320 1g18A2  d.48.1.1 * 9e-06 40.9 %
:HMM:SCOP  1->270 1g19A1 c.37.1.11 * 1.6e-70 31.2 %
:HMM:SCOP  271->335 1u94A2 d.48.1.1 * 8e-15 50.0 %
:RPS:PFM   23->295 PF00154 * RecA e-101 68.0 %
:HMM:PFM   11->334 PF00154 * RecA 6.5e-157 69.9 319/323  
:BLT:SWISS 1->337 RECA_THESQ e-171 100.0 %
:PROS 216->224|PS00321|RECA_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36921.1 GT:GENE AAD36921.1 GT:PRODUCT DNA repair protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1842056..1843126) GB:FROM 1842056 GB:TO 1843126 GB:DIRECTION - GB:PRODUCT DNA repair protein GB:NOTE similar to GB:L23425 SP:P36203 PID:385170 GB:AE000512 percent identity: 100.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD36921.1 GB:DB_XREF GI:4982444 LENGTH 356 SQ:AASEQ MPEEKQKKSVLEKALKRIEENFGKGSIMILGDETQVQPVEVIPTGSLAIDIATGVGGYPRGRIVEIFGQESSGKTTLALHAIAEAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQPDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEGAMGDMQVGLQARLMSQALRKIAGSVNKSKAVVIFTNQIRMKIGVMFGSPETTTGGLALKFYATMRMEVRRGEPIKEGKDVIGNVISVKIVKNKVAPPFKTAQTYIIYGKGIDREYELFNIAVNEGIVDRKGSWYYYTTLKGEEVSLGQGSSNAVQFLKDNPEIAGEIERRIREKYGLLSVEKEEQRKEKKSSGEEAS GT:EXON 1|1-356:0| SW:ID RECA_THESQ SW:DE RecName: Full=Protein recA;AltName: Full=Recombinase A; SW:GN Name=recA; OrderedLocusNames=TRQ2_0960; SW:KW ATP-binding; Complete proteome; Cytoplasm; DNA damage;DNA recombination; DNA repair; DNA-binding; Nucleotide-binding;SOS response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->337|RECA_THESQ|e-171|100.0|337/356| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009432|"GO:SOS response"|SOS response| PROS 216->224|PS00321|RECA_1|PDOC00131| SEG 239->253|vignvisvkivknkv| SEG 321->332|eiageierrire| SEG 338->354|svekeeqrkekkssgee| BL:PDB:NREP 1 BL:PDB:REP 7->319|1ubgA|2e-94|59.6|307/330| RP:PDB:NREP 1 RP:PDB:REP 4->295|3cmxA|7e-58|57.7|291/1603| RP:PFM:NREP 1 RP:PFM:REP 23->295|PF00154|e-101|68.0|272/274|RecA| HM:PFM:NREP 1 HM:PFM:REP 11->334|PF00154|6.5e-157|69.9|319/323|RecA| GO:PFM:NREP 3 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00154|IPR013765| GO:PFM GO:0005524|"GO:ATP binding"|PF00154|IPR013765| GO:PFM GO:0006281|"GO:DNA repair"|PF00154|IPR013765| RP:SCP:NREP 2 RP:SCP:REP 3->270|1g18A1|1e-42|62.1|248/250|c.37.1.11| RP:SCP:REP 272->320|1g18A2|9e-06|40.9|44/60|d.48.1.1| HM:SCP:REP 1->270|1g19A1|1.6e-70|31.2|269/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 271->335|1u94A2|8e-15|50.0|60/0|d.48.1.1|1/1|RecA protein, C-terminal domain| OP:NHOMO 990 OP:NHOMOORG 924 OP:PATTERN --1----1---------1--1-----------121-----------11------1------------- 1231111111111111111-11111111111111111111111311111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111117111111111111111111111111111111111111311111111111-122112112211211111121121111111111111111111111111111111111111122111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111121111111211111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222232111111111111111111111111111111111111111111111111111111111111111111------11111111111111111-11-11111111111111111111111111111111111211111111111111122212222111--11111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111--11111111111111-1111--211-11111111111111111111111111111111 ----1---21-------------------------------------------------------------------------------1-------------------------------------------------------------------------------------111-32-2---336-4----211- -------1------1-------------------------------------------------------------------------------1-------------------------------------------------------------------------------- DISOP:02AL 1-5, 157-169, 336-356| PSIPRED cccHHHHHHHHHHHHHHHHHcccccHHHHcccHHHHccccccccccHHHHHHHccccEEccEEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHcccccccEEEccccHHHHHHHHHHHHHccccEEEEEEcHHHHEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccEEEEcccccccccccccccEEEEEEEEEEEEEEcccccccccccccEEEEEEEEccccccccEEEEEEEcccccccccHHHHHHHHcccEEccccEEEEcccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccccccccccc //