[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36930.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  222/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->229 PF02361 * CbiQ 3e-23 41.5 %
:HMM:PFM   16->227 PF02361 * CbiQ 3.3e-39 33.5 206/224  
:BLT:SWISS 3->243 YBAF_BACSU 7e-34 32.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36930.1 GT:GENE AAD36930.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1849471..1850286) GB:FROM 1849471 GB:TO 1850286 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AL009126 percent identity: 64.86; identified by sequence similarity; putative GB:PROTEIN_ID AAD36930.1 GB:DB_XREF GI:4982453 LENGTH 271 SQ:AASEQ MRLPTVLIGRYIPVDSIVHRLDPRAKLLGMIFLISAVLIVPNLLFYLVPGLAIFLLMFLSRTGFKIYLAGLRSLWFFLVFAVLVQFFSSSEGEKIFWMITDRAIWSAVYIMLRLVLIILLAENFSATTPPLLSARAIESIFSTFGARKIGHEIGMVMTIAMRFVPVLALEADRILKAQIARGANFERGKFFDRIRALVVIIVPLLISALRKAEELAVAMEARLYTGEPPKTRFKDIKWKPMDTLYVLLTAGVLVLVLFGRYFVDGVFQYGS GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 3->243|YBAF_BACSU|7e-34|32.0|241/265| TM:NTM 5 TM:REGION 32->54| TM:REGION 66->88| TM:REGION 105->127| TM:REGION 195->209| TM:REGION 240->262| SEG 73->90|slwfflvfavlvqffsss| SEG 244->257|lyvlltagvlvlvl| RP:PFM:NREP 1 RP:PFM:REP 15->229|PF02361|3e-23|41.5|205/213|CbiQ| HM:PFM:NREP 1 HM:PFM:REP 16->227|PF02361|3.3e-39|33.5|206/224|CbiQ| GO:PFM:NREP 3 GO:PFM GO:0006824|"GO:cobalt ion transport"|PF02361|IPR003339| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF02361|IPR003339| GO:PFM GO:0015087|"GO:cobalt ion transmembrane transporter activity"|PF02361|IPR003339| OP:NHOMO 251 OP:NHOMOORG 232 OP:PATTERN ----------------1---------------------------11---1--1-1-1-111------- -----------------------------------------------------------------------1111111-2231---------------------------------------------------------1-----------------------------------------------11--1111111111111111111111111111111122222222-11111111111111111111111111111111111111111131111111111111111111111111111111111111111111111111111111111111111111111111111111--1-1222112111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1-111111111111-1111111111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccccEEEEcccccEEEccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //