[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36932.1
DDBJ      :             septum site-determining protein MinD
Swiss-Prot:MIND_THEMA   RecName: Full=Septum site-determining protein minD;AltName: Full=Cell division inhibitor minD;

Homologs  Archaea  25/68 : Bacteria  560/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->239 1hyqA PDBj 6e-22 30.3 %
:RPS:PDB   21->239 3ea0A PDBj 7e-26 22.9 %
:RPS:SCOP  21->264 1cp2A  c.37.1.10 * 6e-28 14.5 %
:HMM:SCOP  1->249 1ionA_ c.37.1.10 * 1.4e-57 36.9 %
:RPS:PFM   21->178 PF01656 * CbiA 9e-09 37.9 %
:HMM:PFM   5->210 PF01656 * CbiA 2.3e-37 30.0 170/194  
:BLT:SWISS 21->271 MIND_THEMA e-140 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36932.1 GT:GENE AAD36932.1 GT:PRODUCT septum site-determining protein MinD GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1852767..1853582 GB:FROM 1852767 GB:TO 1853582 GB:DIRECTION + GB:PRODUCT septum site-determining protein MinD GB:NOTE similar to GB:M95582 SP:Q01464 GB:M96343 PID:142859 PID:143216 percent identity: 75.09; identified by sequence similarity; putative GB:PROTEIN_ID AAD36932.1 GB:DB_XREF GI:4982456 LENGTH 271 SQ:AASEQ MGNVIVVTSGKGGVGKTTITANLGCALAKLGEKVCLIDADIGLKNLDIVLGLENRIVYTMIDVVNGKVSPQEALVKHKMLKNLYLLPASQIATKEMISPNDMKAIVKELIPHFDYIIIDSPAGIERGFRNAVAPAERVLVVTTPELPAISDADRVIGLLENFGFSDEKINVIINRFKPHMVKKGEMLTTDDIKHTLSLEIIAVIPDSEDIIVASNTGIPVSLNGNSRISKNFENLARRIRGEGVPLENDFVTVSKGLIDTLKDFFSKLKRG GT:EXON 1|1-271:0| SW:ID MIND_THEMA SW:DE RecName: Full=Septum site-determining protein minD;AltName: Full=Cell division inhibitor minD; SW:GN Name=minD; OrderedLocusNames=TM_1870; SW:KW ATP-binding; Cell cycle; Cell division; Cell membrane;Complete proteome; Membrane; Nucleotide-binding; Septation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 21->271|MIND_THEMA|e-140|100.0|251/271| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| SEG 4->20|vivvtsgkggvgkttit| BL:PDB:NREP 1 BL:PDB:REP 21->239|1hyqA|6e-22|30.3|211/232| RP:PDB:NREP 1 RP:PDB:REP 21->239|3ea0A|7e-26|22.9|214/237| RP:PFM:NREP 1 RP:PFM:REP 21->178|PF01656|9e-09|37.9|132/178|CbiA| HM:PFM:NREP 1 HM:PFM:REP 5->210|PF01656|2.3e-37|30.0|170/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 21->264|1cp2A|6e-28|14.5|241/269|c.37.1.10| HM:SCP:REP 1->249|1ionA_|1.4e-57|36.9|241/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 800 OP:NHOMOORG 605 OP:PATTERN -----------------------21111------1222222221--2------12232233----1-- --1-----11------------------------------1-----------11-----------------------------22122---------------------1--------------------------21233---2211111111111111111111111111111111111111111111-111111111111111111122212111111121211111111--------------------1-1-12-----11--2211---------------------------------------------------22222222222222222222111112--134221123332321222321--1----1-----11111-------111111111111-1121121111--111111111111-------1-------1111111111111-1------------------------------------111111111111111111111111111111111--111212222123121112-1-11-11111111121111112222122--111-1--1-2111---1211-11-1111113122232221122-112212312122122222222222222222221-1222211111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111------222211111---------------1111111111122222222222222222211111111131231111111112222111111111111--11--11111111111111--------------------------2111211111--- -----1--------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1117111--2122-11-12121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 90.4 SQ:SECSTR ####################HHHHHHHTTcTccEEEEEccTTTccGGGTccccccccHHHHHHTGGGccHHHHHHcEEEETTEEEEcccccHHHHHccHHHHHHHHHHHHHHccEEEEEEEccccTTHHHHGGGccEEEEEEcccHHHHHHHHHHHHHHHTcccccccEEEEEEcTTcTcEHHcTTccHHHHHHHHTccEEEEEcccHHHHHHHHHTccHHHcTTcHHHHHHHHHHHccHHcccccccccccHcHHHHHHHHHHT###### DISOP:02AL 271-272| PSIPRED ccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEcccccccccHHccccccccccHHHHHcccccHHHHHccccccccEEEEccccccccccccHHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccHHccHHHHHHHHcccEEEEccccHHHHHHHHccccEEEccccHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHHccc //