[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36933.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->83 PF09743 * DUF2042 6e-04 31.1 %
:HMM:PFM   14->90 PF03776 * MinE 0.0001 26.9 67/70  
:BLT:SWISS 1->90 MINE_ACIF5 9e-05 31.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36933.1 GT:GENE AAD36933.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1853587..1853862 GB:FROM 1853587 GB:TO 1853862 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36933.1 GB:DB_XREF GI:4982457 LENGTH 91 SQ:AASEQ MKFLFWEFGKKNKSRETAKKRLEQIVGTTKRRQMNITEIIPKEILDKNSDKIKERIASWLSETFNVEKEKIKIDLEEREGHVVIITNVFFK GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 1->90|MINE_ACIF5|9e-05|31.6|79/83| RP:PFM:NREP 1 RP:PFM:REP 23->83|PF09743|6e-04|31.1|61/271|DUF2042| HM:PFM:NREP 1 HM:PFM:REP 14->90|PF03776|0.0001|26.9|67/70|MinE| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 11-23| PSIPRED cccEEEccccccccHHHHHHHHHHHHccHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHEEEEEEcccccEEEEEEEEcc //