[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36939.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.28c.92.1
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->248 3cixA PDBj 6e-11 12.4 %
:RPS:SCOP  18->204 1qgoA  c.92.1.2 * 4e-09 10.3 %
:HMM:SCOP  8->202 1r30A_ c.1.28.1 * 2.4e-13 26.6 %
:HMM:PFM   13->224 PF04055 * Radical_SAM 2.2e-22 25.7 152/166  
:BLT:SWISS 77->181 SYY_ONYPE 2e-04 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36939.1 GT:GENE AAD36939.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1858151..1858900) GB:FROM 1858151 GB:TO 1858900 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 58.46; identified by sequence similarity; putative GB:PROTEIN_ID AAD36939.1 GB:DB_XREF GI:4982463 LENGTH 249 SQ:AASEQ MTVDPSHTIPVSVTGAFCSLNCPHCGAHYLRHMISVDEIPALVKKGYRSFLISGGMLPDGSIPFEKYYEHLKELKESHGLLYNFHVGFQKSKVAKELADVVSMDFFGDETVLKSIYGLALTPQEILDIAHFYENVVFHITVGITGGKITHEEKALEILSQETDTVVLNVFIPTPGTKFGKSFPPDLQEVVKLFEKARKLFKRVILGCMQPRGEYRKKLQSELKDLVDVITKPVGGTGEFKGCCAFIGRG GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 77->181|SYY_ONYPE|2e-04|33.3|93/100| SEG 65->76|ekyyehlkelke| RP:PDB:NREP 1 RP:PDB:REP 4->248|3cixA|6e-11|12.4|241/345| HM:PFM:NREP 1 HM:PFM:REP 13->224|PF04055|2.2e-22|25.7|152/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 18->204|1qgoA|4e-09|10.3|185/257|c.92.1.2| HM:SCP:REP 8->202|1r30A_|2.4e-13|26.6|188/312|c.1.28.1|1/1|Radical SAM enzymes| OP:NHOMO 42 OP:NHOMOORG 41 OP:PATTERN --1-112111111111--------------------------------------1111111---1--- ---1-------------------------------------------------------------------------------11-------------------------------------------------1-----------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------1------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 247 STR:RPRED 99.2 SQ:SECSTR #ccEEEEEEEEEEEccccccccTTcTTcTTcccccHHHHHHHHHTTccEEEEEEcccGGGTTHHHHHHHHHHHHHHTTccEEEEEcccccHHHHHHHHHTTccEEEccHHHHHHHcTTccHHHHHHHHHHTTcEEEEccEEccTTccHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHHHHcTHHHHcTHHHHHHTTTccEEccccccTTTGGGcccccccTTTTccTTc# DISOP:02AL 1-4| PSIPRED cccccccccEEEEEccccccHHHHHHHHHHcccccHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHccEEEEEEEcccHHHHHHHHHHHHHHEEcccHHHHHHccccccHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcHHHHHccccc //