[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80351.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:180 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->180 2ywlA PDBj 8e-82 98.9 %
:RPS:PDB   3->28,118->177 2cfyA PDBj 2e-07 15.0 %
:RPS:PDB   4->47 1b37A PDBj 3e-10 38.6 %
:RPS:SCOP  2->174 1fl2A1  c.3.1.5 * 4e-11 19.9 %
:HMM:SCOP  1->179 1hyuA1 c.3.1.5 * 1.9e-29 34.3 %
:RPS:PFM   3->31 PF05834 * Lycopene_cycl 9e-07 65.5 %
:RPS:PFM   3->49 PF01134 * GIDA 1e-04 40.4 %
:HMM:PFM   3->117 PF07992 * Pyr_redox_2 3e-12 27.2 114/202  
:HMM:PFM   120->142 PF07992 * Pyr_redox_2 0.00018 43.5 23/202  
:BLT:SWISS 3->81 TRXB_STRCO 9e-09 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80351.1 GT:GENE AAS80351.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(2097..2639) GB:FROM 2097 GB:TO 2639 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80351.1 GB:DB_XREF GI:46195933 LENGTH 180 SQ:AASEQ MWDVIVVGGGPSGLSAALFLARAGLKVLVLDGGRSKVKGVTRVPNYPGLLDEPSGEELLRRLEAHARRYGAEVRPGVVKGVRDMGGVFEVETEEGVEKAERLLLCTHKDPTLPSLLGLTRRGAYIDTDEGGRTSYPRVYAAGVARGKVPGHAIISAGDGAYVAVHLVSDLRGEPYKDHAL GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 3->81|TRXB_STRCO|9e-09|38.0|79/322| SEG 56->68|eellrrleaharr| SEG 85->97|ggvfeveteegve| BL:PDB:NREP 1 BL:PDB:REP 2->180|2ywlA|8e-82|98.9|178/178| RP:PDB:NREP 2 RP:PDB:REP 3->28,118->177|2cfyA|2e-07|15.0|86/484| RP:PDB:REP 4->47|1b37A|3e-10|38.6|44/459| RP:PFM:NREP 2 RP:PFM:REP 3->31|PF05834|9e-07|65.5|29/368|Lycopene_cycl| RP:PFM:REP 3->49|PF01134|1e-04|40.4|47/391|GIDA| HM:PFM:NREP 2 HM:PFM:REP 3->117|PF07992|3e-12|27.2|114/202|Pyr_redox_2| HM:PFM:REP 120->142|PF07992|0.00018|43.5|23/202|Pyr_redox_2| GO:PFM:NREP 4 GO:PFM GO:0016117|"GO:carotenoid biosynthetic process"|PF05834|IPR008671| GO:PFM GO:0016705|"GO:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen"|PF05834|IPR008671| GO:PFM GO:0008033|"GO:tRNA processing"|PF01134|IPR002218| GO:PFM GO:0050660|"GO:FAD binding"|PF01134|IPR002218| RP:SCP:NREP 1 RP:SCP:REP 2->174|1fl2A1|4e-11|19.9|171/184|c.3.1.5| HM:SCP:REP 1->179|1hyuA1|1.9e-29|34.3|175/0|c.3.1.5|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -----------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------11----------11-----------------------------------------------------------------------------------------------------------------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 100.0 SQ:SECSTR ccEEEEEcccHHHHHHHHHHHHTTcccEEEEcccccccTTccEEEETTHHHEccHHHHHHHHHHHHHHTTcEEEccEEEEEcccccEEEEETTccEEEEcEEEEcccEEEcccccTHHcTTTccccccTTcccccTTEEEcGGGTccEcccHHHHHHHHHHHHHHHHTTTcccccccccc PSIPRED cEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEcccEEEEcEEEEEcccccccccccccccccEEEEEccccccccccEEEEccccccccEEEEEEcccHHHHHHHHHHHcccccEEEccc //