[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80364.1
DDBJ      :             prolipoprotein diacylglyceryl transferase
Swiss-Prot:LGT_THET2    RecName: Full=Prolipoprotein diacylglyceryl transferase;         EC=2.4.99.-;

Homologs  Archaea  0/68 : Bacteria  603/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:283 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->231 PF01790 * LGT 4e-25 41.5 %
:HMM:PFM   1->273 PF01790 * LGT 2.6e-68 38.9 247/257  
:BLT:SWISS 1->283 LGT_THET2 e-150 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80364.1 GT:GENE AAS80364.1 GT:PRODUCT prolipoprotein diacylglyceryl transferase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 14595..15446 GB:FROM 14595 GB:TO 15446 GB:DIRECTION + GB:PRODUCT prolipoprotein diacylglyceryl transferase GB:PROTEIN_ID AAS80364.1 GB:DB_XREF GI:46195946 LENGTH 283 SQ:AASEQ MDPVMVQIGPLAIRWYGVLLTLAIFLGYELARRRLRAWGWDLEPFERVVFWAVVFGVVGARLGYVLTSPGYFLENPLEALYIWHGGLSFHGAILGGALTFYYFHRRRGYPLWPYLDAATPGVALGIVAGRIGNLMNGSDTVGRLTTLPIGFTWPEWARGFPGVCPGIDDISEVYRCAELLRGPVHLTQVYGAVVGLILLFLSLYWLRKRPFYGYAFWQFVLWYSVLRSVLEEPFRLNPLWLPVYRNDELGIGLFTATQVVSLPLVLLSLYMLRRLGKGEASRR GT:EXON 1|1-283:0| SW:ID LGT_THET2 SW:DE RecName: Full=Prolipoprotein diacylglyceryl transferase; EC=2.4.99.-; SW:GN Name=lgt; OrderedLocusNames=TT_C0016; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transferase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->283|LGT_THET2|e-150|100.0|283/283| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 7->29| TM:REGION 48->70| TM:REGION 114->136| TM:REGION 185->206| TM:REGION 250->272| SEG 47->61|rvvfwavvfgvvgar| SEG 259->275|vvslplvllslymlrrl| RP:PFM:NREP 1 RP:PFM:REP 3->231|PF01790|4e-25|41.5|212/251|LGT| HM:PFM:NREP 1 HM:PFM:REP 1->273|PF01790|2.6e-68|38.9|247/257|LGT| GO:PFM:NREP 4 GO:PFM GO:0009249|"GO:protein lipoylation"|PF01790|IPR001640| GO:PFM GO:0016020|"GO:membrane"|PF01790|IPR001640| GO:PFM GO:0016757|"GO:transferase activity, transferring glycosyl groups"|PF01790|IPR001640| GO:PFM GO:0042158|"GO:lipoprotein biosynthetic process"|PF01790|IPR001640| OP:NHOMO 617 OP:NHOMOORG 604 OP:PATTERN -------------------------------------------------------------------- ----1-11111-------------1-------1-1--1----------1---1--1------11----111-111---11-1---1-----11111-----------11----------------11111-11211-1111----1----111--111------1---------1-----1--111111--11--------------1-1111--------1-11------1--------------------1-11-11---1-----11-1----1211111---111111111111111111111111111-111111111-12121111111-111---1-----------1-1--2111-1-111--1--1-1111111---11111111111111111111111-1111121111111111111111111111-211111111111111111111--1111111111111--111111111111111111-1111111111111111111111111111111-1111111111111111111111111111111111111111111-11111211121111111111111-11---111111-1111-----------1111-111111211111111111-1-111111--1--1-11111---11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111-122111111111111111111111111111111111111111111111111111111111111-------------------------------------------1111-111-11-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 280-283| PSIPRED cccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccHHHHHHcccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //