[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80373.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->98 PF04892 * VanZ 2.6e-12 29.7 64/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80373.1 GT:GENE AAS80373.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 21926..22264 GB:FROM 21926 GB:TO 22264 GB:DIRECTION + GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS80373.1 GB:DB_XREF GI:46195955 LENGTH 112 SQ:AASEQ MRPFYALLALLWMGVLWWLSERPFPGAGLPHPWDKLAHFLAYALLGALWRRGLGRFLPAFLLAAFYGVVDEAHQSLVPGREAFGLDFVADFLGAYVGARGAGRWEAPEASRP GT:EXON 1|1-112:0| TM:NTM 3 TM:REGION 1->23| TM:REGION 28->49| TM:REGION 52->74| SEG 40->57|layallgalwrrglgrfl| HM:PFM:NREP 1 HM:PFM:REP 34->98|PF04892|2.6e-12|29.7|64/133|VanZ| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 108-112| PSIPRED ccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //