[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80381.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.106.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->130 1wfrA PDBj 2e-65 100.0 %
:RPS:PDB   2->130 2cx7A PDBj 6e-21 91.4 %
:RPS:SCOP  1->130 1wfrA  d.106.1.1 * 4e-42 92.3 %
:HMM:SCOP  1->129 1wfrA_ d.106.1.1 * 2.4e-32 30.2 %
:HMM:PFM   10->105 PF02036 * SCP2 1.1e-13 24.4 86/102  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80381.1 GT:GENE AAS80381.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(30084..30476) GB:FROM 30084 GB:TO 30476 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80381.1 GB:DB_XREF GI:46195963 LENGTH 130 SQ:AASEQ MELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVA GT:EXON 1|1-130:0| SEG 110->119|aalapyaqaa| BL:PDB:NREP 1 BL:PDB:REP 1->130|1wfrA|2e-65|100.0|130/143| RP:PDB:NREP 1 RP:PDB:REP 2->130|2cx7A|6e-21|91.4|128/128| HM:PFM:NREP 1 HM:PFM:REP 10->105|PF02036|1.1e-13|24.4|86/102|SCP2| RP:SCP:NREP 1 RP:SCP:REP 1->130|1wfrA|4e-42|92.3|130/143|d.106.1.1| HM:SCP:REP 1->129|1wfrA_|2.4e-32|30.2|129/0|d.106.1.1|1/1|Sterol carrier protein, SCP| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN 11------1111111---11-1----------------------------------------11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 100.0 SQ:SECSTR HcTTcHHHHHHHHHHHHTcHHHHHHTTTcEEEEEEEEcccGGGTcTTcEEEEEEEETTEEEEEEEEEccccccEEEEEcHHHHHHHTTTcccHHHHHHHTccEEEEccHHHHGGGHHHHHHHHHHHHTcc DISOP:02AL 130-131| PSIPRED cccccHHHHHHHHHHHcccHHHHHHccccccEEEEEEEcccccccccccEEEEEEEcccEEEEEEEcccccccEEEEEEHHHHHHHHHccccHHHHHHccEEEEEcccHHHHHHHHHHHHHHHHHHHHcc //