[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80382.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80382.1 GT:GENE AAS80382.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 30522..30950 GB:FROM 30522 GB:TO 30950 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80382.1 GB:DB_XREF GI:46195964 LENGTH 142 SQ:AASEQ MVYLLDLSGVYCEPVEPRLLRLLAEESGEPVFYLSEAFYALLPLLKAEGAQALEALFPGASRLYPKAFRPRGLAFPEPFHLVSDLPPPEGVLAYHAPDKLEALALALEALGLAPGEAVYWDDNPLWVERARGLGVRAELFLP GT:EXON 1|1-142:0| SEG 100->117|lealalalealglapgea| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 59-60,62-62,67-67,73-73,81-81,87-87,90-90,95-95,142-143| PSIPRED cEEEEEccccccccccHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccEEEEcccHHHHHHHHHHHHHccccccEEEEcccccEEEEccccccEEEEccc //