[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80390.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80390.1 GT:GENE AAS80390.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 39291..39608 GB:FROM 39291 GB:TO 39608 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80390.1 GB:DB_XREF GI:46195972 LENGTH 105 SQ:AASEQ MVVLDYGAPTKRRGGVYRPPQGNELDPVYARFKQGLAALAQRRPPLWAQGLVEGCWVLEIDTRQAPLLLRPEEAVAEGEAFLDALVGELRRREPLLFLDQGQKPL GT:EXON 1|1-105:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 104-105| PSIPRED cEEEccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHcccEEEEEccccccEEEccHHHHHHHHHHHHHHHHHHHHcccEEEEccccccc //