[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80394.1
DDBJ      :             acyl carrier protein
Swiss-Prot:ACP_THET8    RecName: Full=Acyl carrier protein;         Short=ACP;

Homologs  Archaea  0/68 : Bacteria  799/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:80 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->80 1x3oA PDBj 1e-40 100.0 %
:RPS:PDB   2->77 3ejbA PDBj 2e-17 57.9 %
:RPS:SCOP  5->76 1f80D  a.28.1.1 * 7e-18 61.1 %
:HMM:SCOP  1->79 1klpA_ a.28.1.1 * 3.2e-23 40.5 %
:RPS:PFM   10->75 PF00550 * PP-binding 3e-05 40.0 %
:HMM:PFM   8->75 PF00550 * PP-binding 5.3e-18 38.8 67/67  
:BLT:SWISS 1->80 ACP_THET8 4e-40 100.0 %
:PROS 34->49|PS00012|PHOSPHOPANTETHEINE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80394.1 GT:GENE AAS80394.1 GT:PRODUCT acyl carrier protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(43347..43589) GB:FROM 43347 GB:TO 43589 GB:DIRECTION - GB:PRODUCT acyl carrier protein GB:PROTEIN_ID AAS80394.1 GB:DB_XREF GI:46195976 LENGTH 80 SQ:AASEQ MTEQEIFEKVKAVIADKLQVEPEKVTLEARFIEDLGADSLDTVELIMGLEDEFGLEISDEEAEKIRTVKDAVEYIKAKLG GT:EXON 1|1-80:0| SW:ID ACP_THET8 SW:DE RecName: Full=Acyl carrier protein; Short=ACP; SW:GN Name=acpP; OrderedLocusNames=TTHA0414; SW:KW 3D-structure; Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Phosphopantetheine. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->80|ACP_THET8|4e-40|100.0|80/80| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| PROS 34->49|PS00012|PHOSPHOPANTETHEINE|PDOC00012| BL:PDB:NREP 1 BL:PDB:REP 1->80|1x3oA|1e-40|100.0|80/80| RP:PDB:NREP 1 RP:PDB:REP 2->77|3ejbA|2e-17|57.9|76/78| RP:PFM:NREP 1 RP:PFM:REP 10->75|PF00550|3e-05|40.0|65/67|PP-binding| HM:PFM:NREP 1 HM:PFM:REP 8->75|PF00550|5.3e-18|38.8|67/67|PP-binding| GO:PFM:NREP 1 GO:PFM GO:0048037|"GO:cofactor binding"|PF00550|IPR006163| RP:SCP:NREP 1 RP:SCP:REP 5->76|1f80D|7e-18|61.1|72/74|a.28.1.1| HM:SCP:REP 1->79|1klpA_|3.2e-23|40.5|79/115|a.28.1.1|1/1|ACP-like| OP:NHOMO 1147 OP:NHOMOORG 950 OP:PATTERN -------------------------------------------------------------------- 1111----111---1------1---1------111111111212--111--1-1---11111---111-11-----------11111111111-1111-111111111111111111111111111111111111111111111111112111111111111111112121111111111111111111112111111111111111111-11111111111111111111---1111111111111111111212211221211122112111221111111222211-----------1111111111111211122111111221222222222212112111--1--1231111111111111111-11111211111111111111111111111111111112-111111111111-2-1111111421111111111111111111111111111111---11111----11111111111111111111211111112112121111111221111111121111112231111111111111111-1111121111111111111121-1-11111--1-11111211112111111111111111121111211111111221-111111121111111-11111221211-11111------21111211222111-11-21111111112121111121111122111111111111111111111111111111111111111111122222211111111111-1111111111111111111111111112212111111232111111111111111111111211111111111111111111111111111111111111111---------------------2212211122111 11----1-311--11111-1-1111-1111111-11-1111111-1-1111111111-1111211-11121-21211111-2222211----1-1-11111--233-1712111121-111-1122-21151-111-11-2111111---1--1-1111--1111-1214212122111F1--21779816521----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 100.0 SQ:SECSTR cccccHHHHHHHHHHHHccccTTTccTTccTTTTTcccTTHHHHHHHHHHHHTTccccHHHHHHcccHHHHHHHHHHccc PSIPRED ccHHHHHHHHHHHHHHHHcccHHHccccccHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHcc //