[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80399.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   60->174 PF02620 * DUF177 2e-10 34.2 %
:HMM:PFM   60->175 PF02620 * DUF177 8.3e-30 41.4 116/119  
:BLT:SWISS 60->167 Y2951_MYCBO 3e-05 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80399.1 GT:GENE AAS80399.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(46644..47180) GB:FROM 46644 GB:TO 47180 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80399.1 GB:DB_XREF GI:46195981 LENGTH 178 SQ:AASEQ MDYTTTTSINLARLLKEGGTARAQGVVQEAFVVGEERFPLQGEASWRVAISSVGGNEYWLSGEVEGVVLMECRRCLRPTPTRIHAHFQHLLHYEPGLEEVVFHEEGEEEFYAFGLPDLDLLPFLTEAFVTEMPYTVLCEEGCKGLCPVCGADRNVEDCGHEPEAFHPFLGLKDLLPEL GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 60->167|Y2951_MYCBO|3e-05|40.4|104/207| SEG 98->110|eevvfheegeeef| SEG 113->124|fglpdldllpfl| RP:PFM:NREP 1 RP:PFM:REP 60->174|PF02620|2e-10|34.2|114/116|DUF177| HM:PFM:NREP 1 HM:PFM:REP 60->175|PF02620|8.3e-30|41.4|116/119|DUF177| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-------------------------------------------------------------1---------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 153-162| PSIPRED cccEEEEEEEHHHHHccccccHHHcEEEHHEEcccccccccccEEEEEEEEEccccEEEEEEEEEEEEEEEEccccccccEEEEEEEEEEEEcccccccccccccccccEEEEccccccHHHHHHHHHHHHccccccccHHcccccccccccccccccccccccccHHHHHHHHcccc //