[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80413.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->59 PF08672 * APC2 6.3e-06 40.5 37/60  
:BLT:SWISS 7->46 EFCB2_MOUSE 8e-04 45.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80413.1 GT:GENE AAS80413.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(58360..58590) GB:FROM 58360 GB:TO 58590 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80413.1 GB:DB_XREF GI:46195995 LENGTH 76 SQ:AASEQ MDRKGWVMRAVEALRLATFKEIQRYLDEEGEPFSKKELLDTLKALVAEGLLEEKEGVYRPARKKGSAEAFRRLFGD GT:EXON 1|1-76:0| BL:SWS:NREP 1 BL:SWS:REP 7->46|EFCB2_MOUSE|8e-04|45.0|40/100| HM:PFM:NREP 1 HM:PFM:REP 23->59|PF08672|6.3e-06|40.5|37/60|APC2| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHcc //