Thermus thermophilus HB27 (tthe0)
Gene : AAS80414.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80414.1 GT:GENE AAS80414.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 58631..59116 GB:FROM 58631 GB:TO 59116 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80414.1 GB:DB_XREF GI:46195996 LENGTH 161 SQ:AASEQ MDPYREYQDYVMASRLLVASGLSREILTLAQYARLRLKRLELARARRFRELEALDRRLRYGFWTDPLRLREHLHPLRDSPYLADPEAFERLLFPEERARLRYPGQAGEYYLGWLRLPPLLMEPWAFEESLRAQEEKGRALPLFLNAFHLGPGGREGPWRGR GT:EXON 1|1-161:0| SEG 33->59|arlrlkrlelararrfrelealdrrlr| SEG 66->77|plrlrehlhplr| SEG 150->160|gpggregpwrg| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 132-135, 154-161| PSIPRED ccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccHHHHHHHHccHHHHHcccccccccHHHHHHHccHHHHccccHHHHHHHHHHccccccHHHHEEEccccccccccccc //