[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80423.1
DDBJ      :             probable membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  797/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
a.59.1
:430 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   273->344 1e91A PDBj 3e-15 11.1 %
:RPS:SCOP  273->344 1e91A  a.59.1.1 * 1e-15 11.1 %
:RPS:PFM   270->425 PF02096 * 60KD_IMP 2e-40 54.5 %
:HMM:PFM   247->424 PF02096 * 60KD_IMP 2.1e-65 51.7 178/196  
:BLT:SWISS 125->406 OXAA_DEIRA 1e-45 39.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80423.1 GT:GENE AAS80423.1 GT:PRODUCT probable membrane protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(65913..67205) GB:FROM 65913 GB:TO 67205 GB:DIRECTION - GB:PRODUCT probable membrane protein GB:PROTEIN_ID AAS80423.1 GB:DB_XREF GI:46196005 LENGTH 430 SQ:AASEQ MKRLLAAFLFLLPALALEVGFKDADVNGDGTPEKVAVTNLMDLAFNEAGQVVGWYVKAYKGTAFGDYARAPNLAANGPVLSPVGFRPLEAEFAVEDGHLLARFRGEEGTLTYRIPKERYTAEVTADFPLVLKLSAQGNPKALLEGAAEPAPSGEGRLVYLAWQTRPKAGYALVAFGEGPLEGRLVGREGEVRLGPGEILRVYGGQNELVRFHVEGLLSFPGLFSPNLWGQLSLGLLWIMEAAYRFTGNWGLAILFLTLVVRLLLWPLMHQQFKSMAEIQRLQPLIQKINEKYKDDPNKRAEATMKLYQEHRVNPAAGCLPLLIQMPILFILWKVIANYEFGQGFLWIPDLALPDPYYILPVLYVASTFLSTWLSAHGNRDLIRQSLFMNLIFVFLVLQFPSGVTLYWVLSTLIGLVQQWLINKSLAPLKA GT:EXON 1|1-430:0| BL:SWS:NREP 1 BL:SWS:REP 125->406|OXAA_DEIRA|1e-45|39.1|274/428| TM:NTM 5 TM:REGION 4->23| TM:REGION 247->269| TM:REGION 314->336| TM:REGION 355->377| TM:REGION 393->415| SEG 4->17|llaaflfllpalal| SEG 251->267|lailfltlvvrlllwpl| RP:PDB:NREP 1 RP:PDB:REP 273->344|1e91A|3e-15|11.1|72/85| RP:PFM:NREP 1 RP:PFM:REP 270->425|PF02096|2e-40|54.5|156/191|60KD_IMP| HM:PFM:NREP 1 HM:PFM:REP 247->424|PF02096|2.1e-65|51.7|178/196|60KD_IMP| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF02096|IPR001708| GO:PFM GO:0051205|"GO:protein insertion into membrane"|PF02096|IPR001708| RP:SCP:NREP 1 RP:SCP:REP 273->344|1e91A|1e-15|11.1|72/85|a.59.1.1| OP:NHOMO 917 OP:NHOMOORG 831 OP:PATTERN -------------------------------------------------------------------- 1111-11111111-11112-1-111-111111----11--1-------1---1--111----111-21111-----111111211111111111111--111111111111111111111111111111111111111111---11111111-11--------11-1---1------------11111111121222222222222222221112222222111112222112--------------------111111111111111111111111112221111111111111111111111111111111111111111112111111111111111221111-11111--1111111-11111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------1111111111111 ------1-------------------------------------------------------------------------------1----------11---1-----2--11---2----------------------------------------11---1-----------11222N223222116-3221-11-3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 16.7 SQ:SECSTR ################################################################################################################################################################################################################################################################################cccHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHTTccccccccccccHHHHHHHHHHHTcccHHHHHH###################################################################################### DISOP:02AL 1-2, 289-305, 370-385, 428-430| PSIPRED cHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEcHHcHHHHccEEEEEEEcccHHHccHHHHHccccccccccccccccccccccHHEEEcccccccccccccEEEEEEEcccccHHHHHHHcccEEEEcccHHHHHHHHccEEccccccccEEEEEEccccccEEEEEccccccccccccccccEEcccccEEEEEEcHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccEEEHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //