[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80439.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->136 3ef5B PDBj 6e-12 17.7 %
:RPS:SCOP  1->134 2azwA1  d.113.1.1 * 3e-10 12.8 %
:HMM:SCOP  1->136 1ryaA_ d.113.1.5 * 1.3e-27 40.4 %
:HMM:PFM   14->127 PF00293 * NUDIX 5.1e-21 32.5 114/135  
:BLT:SWISS 95->129 NUDI_SHISS 3e-04 48.6 %
:PROS 39->60|PS00893|NUDIX_BOX
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80439.1 GT:GENE AAS80439.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 80754..81164 GB:FROM 80754 GB:TO 81164 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80439.1 GB:DB_XREF GI:46196021 LENGTH 136 SQ:AASEQ MEDRPQYPIPTVGALAEKEGLVLLVRTAKWRGLWGVPGGKVAWGEALEEALRREFREEVGLALSQVRFALVQEAIFSPEFYKPTHMLLFNYFARAEGEVRPNEEILEWAWVEPEKGLAYPLNAFTRALLVRYLEGR GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 95->129|NUDI_SHISS|3e-04|48.6|35/141| PROS 39->60|PS00893|NUDIX_BOX|PDOC00695| SEG 45->58|ealeealrrefree| RP:PDB:NREP 1 RP:PDB:REP 7->136|3ef5B|6e-12|17.7|124/129| HM:PFM:NREP 1 HM:PFM:REP 14->127|PF00293|5.1e-21|32.5|114/135|NUDIX| RP:SCP:NREP 1 RP:SCP:REP 1->134|2azwA1|3e-10|12.8|133/146|d.113.1.1| HM:SCP:REP 1->136|1ryaA_|1.3e-27|40.4|136/160|d.113.1.5|1/1|Nudix| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------1---------------------------------------1-----1------------11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 100.0 SQ:SECSTR cccccccEEEEEEEEcEETTEEEEEEcccccccEEccEEEccTTccHHHHHHHHHHHHHccEEEcccEEEEEEEEETTEcTTTEEEEEEEEEccEEEcccccccccEEEEEcGGGGGGccccHHHHTTHHHHHHHT DISOP:02AL 1-3| PSIPRED ccccccccEEEEEEEEEcccEEEEEEEcccccEEEccccEEcccccHHHHHHHHHHHHcccEEEEEEEEEEEccEEcccccccEEEEEEEEEEEccccccccccHHEEEEccHHHHHcccccHHHHHHHHHHHHcc //