[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80441.1
DDBJ      :             probable transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->62 PF11127 * DUF2892 2e-08 50.8 %
:HMM:PFM   1->62 PF11127 * DUF2892 1.7e-22 46.8 62/66  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80441.1 GT:GENE AAS80441.1 GT:PRODUCT probable transmembrane protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 82076..82267 GB:FROM 82076 GB:TO 82267 GB:DIRECTION + GB:PRODUCT probable transmembrane protein GB:PROTEIN_ID AAS80441.1 GB:DB_XREF GI:46196023 LENGTH 63 SQ:AASEQ MPVNESTTDRVIRFLLSLVLFYFAFQSAAPWNWILGIVAAVLLFTAITGFCGLYRVLGISTKR GT:EXON 1|1-63:0| TM:NTM 2 TM:REGION 4->26| TM:REGION 35->57| RP:PFM:NREP 1 RP:PFM:REP 4->62|PF11127|2e-08|50.8|59/67|DUF2892| HM:PFM:NREP 1 HM:PFM:REP 1->62|PF11127|1.7e-22|46.8|62/66|DUF2892| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 62-63| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //