[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80444.1
DDBJ      :             thioredoxin reductase
Swiss-Prot:FENR_THET2   RecName: Full=Ferredoxin--NADP reductase;         Short=Fd-NADP+ reductase;         Short=FNR;         EC=1.18.1.2;

Homologs  Archaea  66/68 : Bacteria  847/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.3.1
:335 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->335 2zbwB PDBj e-171 99.7 %
:RPS:PDB   2->303 2a87A PDBj 1e-33 28.1 %
:RPS:SCOP  2->63 2vouA1  c.3.1.2 * 9e-09 12.9 %
:RPS:SCOP  124->295 1f8gA1  c.2.1.4 * 1e-17 14.1 %
:HMM:SCOP  1->318 1sezA1 c.3.1.2 * 5.2e-47 26.8 %
:RPS:PFM   7->288 PF07992 * Pyr_redox_2 1e-11 34.0 %
:HMM:PFM   7->291 PF07992 * Pyr_redox_2 2.2e-35 29.6 196/202  
:BLT:SWISS 1->335 FENR_THET2 e-178 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80444.1 GT:GENE AAS80444.1 GT:PRODUCT thioredoxin reductase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(83829..84836) GB:FROM 83829 GB:TO 84836 GB:DIRECTION - GB:PRODUCT thioredoxin reductase GB:PROTEIN_ID AAS80444.1 GB:DB_XREF GI:46196026 LENGTH 335 SQ:AASEQ MAADHTDVLIVGAGPAGLFAGFYVGMRGLSFRFVDPLPEPGGQLTALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYSLGERAETLEREGDLFKVTTSQGNAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKAEFQGKRVLIVGGGDSAVDWALNLLDTARRITLIHRRPQFRAHEASVKELMKAHEEGRLEVLTPYELRRVEGDERVRWAVVFHNQTQEELALEVDAVLILAGYITKLGPLANWGLALEKNKIKVDTTMATSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYANPALKVNPGHSSEKAAPGT GT:EXON 1|1-335:0| SW:ID FENR_THET2 SW:DE RecName: Full=Ferredoxin--NADP reductase; Short=Fd-NADP+ reductase; Short=FNR; EC=1.18.1.2; SW:GN OrderedLocusNames=TT_C0096; SW:KW Complete proteome; FAD; Flavoprotein; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->335|FENR_THET2|e-178|100.0|335/335| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 112->121|aviiaagvga| SEG 305->319|aaiaanhaaayanpa| BL:PDB:NREP 1 BL:PDB:REP 2->335|2zbwB|e-171|99.7|331/331| RP:PDB:NREP 1 RP:PDB:REP 2->303|2a87A|1e-33|28.1|292/313| RP:PFM:NREP 1 RP:PFM:REP 7->288|PF07992|1e-11|34.0|262/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 7->291|PF07992|2.2e-35|29.6|196/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 2->63|2vouA1|9e-09|12.9|62/265|c.3.1.2| RP:SCP:REP 124->295|1f8gA1|1e-17|14.1|156/181|c.2.1.4| HM:SCP:REP 1->318|1sezA1|5.2e-47|26.8|299/374|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1726 OP:NHOMOORG 970 OP:PATTERN 11121124333333332122111111111111111111111111111111--1111121112111111 1111311111121211112-11111211111112222233242111221111332111--22222332511122222221111-3---2222-222---211133213121111111111111113322232223311123111221-1-----------1-----1---1-1-11-1--11123133111344444444444444444345534444333434433333346333333333333333322333322222222222332232243233333332332332222222222223333333333332222222223-1114222222212112111221112214-13-23-2111232222-2-111-22211-1112233422233232111-112211311111111112212111112111111311111-1111111111111112333222322221111221122222222222222221122131122112442422----22531111-233433343333333343333233222122211111111111112221111333224332111111112111211113121-122222221222222222111112322223122122222222222222222221-2111111111122221212222222222-2232222222222222223222221122222112111222222122222221111111111111111-2111111111121121111-11111-11114332412111122222222232222322211111111111112111111222243213112232222111111----11111111113----1-1-1112111111211-1111111112111111 ----111-------111-1----1-1----111-------------111-1111-1--111-111111-11-111-1-111111111-----1-----------1-1-1------------------------------------------------------1-----------121--11-----------11---2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 335 STR:RPRED 100.0 SQ:SECSTR EccccEEEEEEccHHHHHHHHHHHHHTTcccEEEcccccccGGGccccccccTTcTTcccHccHHHHHHHHHHHHHHTTcEEEcccEEEEEEcccccEEEEETTccEEEEEEEEEEEEcccEEEcccccTHHHHTcTTTEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccccTTHHTHHHHHHHcTTEEEEccEEEEEEEccccccEEEEEEETTcccEEEccccEEEcccEEEccTTTcTTccccTccccccTTccccccTTEEEcGGGTccccccHHHHHHHHGHHHHHHHHHHHHcTTcccccccGGGcccTTc DISOP:02AL 1-2, 329-335| PSIPRED cccccEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccEEEccccccEEEcccccccccHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEccccEEEEEEEEEEEcccccccccccccccHHEEcccEEEEccccHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEEEcccccEEEEEEcEEEEEEEEcccHHHHHHccEEEcccEEEEccccccccccEEEEEEEEcccccEEEEEHHHHHHHHHHHHHHHHcccccccccccccccccccc //