[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80457.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1d.58.48
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   110->183 1xxlA PDBj 2e-09 45.2 %
:RPS:PDB   82->165 1eg2A PDBj 1e-12 20.5 %
:RPS:PDB   152->182 1eaoA PDBj 8e-06 12.9 %
:RPS:SCOP  17->66 1yqhA1  d.58.48.1 * 4e-05 28.0 %
:RPS:SCOP  110->181 2avnA1  c.66.1.41 * 5e-13 42.3 %
:HMM:SCOP  1->114 1s7hA_ d.58.48.2 * 1.5e-27 42.0 %
:HMM:SCOP  96->228 1vl5A_ c.66.1.41 * 2.4e-30 45.9 %
:RPS:PFM   20->66 PF01910 * DUF77 3e-04 34.0 %
:RPS:PFM   111->181 PF08241 * Methyltransf_11 8e-11 52.1 %
:HMM:PFM   111->194 PF08241 * Methyltransf_11 2.6e-21 40.5 84/95  
:HMM:PFM   4->66 PF07615 * Ykof 4.2e-07 33.3 63/81  
:BLT:SWISS 11->111 Y052_STRM5 2e-04 29.5 %
:BLT:SWISS 98->181 UBIE_CHLTE 3e-11 39.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80457.1 GT:GENE AAS80457.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 97645..98394 GB:FROM 97645 GB:TO 98394 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80457.1 GB:DB_XREF GI:46196039 LENGTH 249 SQ:AASEQ MAVKALFALYPLLQGDYRAVEKALLALEESGASYRVFPTHSEVSGKEEEVFLTLQRAFQKAAEEGALVMWALLTNACEAGDPFRKEERLRRFPPGEIARKALEGLKAKSVLDIGTGTGVFAEAFAALGLFVVGLDPRADRLEVARAKVKGARFVEGRAEALPFPDGSFDLAFFGLALHHLDPVPALREASRVARRVAVLEWPYREEEVGPPLGRRFSLEALEGLFREALGSPPRFLVAEGYVLALWDKG GT:EXON 1|1-249:0| BL:SWS:NREP 2 BL:SWS:REP 11->111|Y052_STRM5|2e-04|29.5|95/216| BL:SWS:REP 98->181|UBIE_CHLTE|3e-11|39.3|84/242| SEG 185->200|alreasrvarrvavle| BL:PDB:NREP 1 BL:PDB:REP 110->183|1xxlA|2e-09|45.2|73/231| RP:PDB:NREP 2 RP:PDB:REP 82->165|1eg2A|1e-12|20.5|78/270| RP:PDB:REP 152->182|1eaoA|8e-06|12.9|31/124| RP:PFM:NREP 2 RP:PFM:REP 20->66|PF01910|3e-04|34.0|47/92|DUF77| RP:PFM:REP 111->181|PF08241|8e-11|52.1|71/96|Methyltransf_11| HM:PFM:NREP 2 HM:PFM:REP 111->194|PF08241|2.6e-21|40.5|84/95|Methyltransf_11| HM:PFM:REP 4->66|PF07615|4.2e-07|33.3|63/81|Ykof| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 2 RP:SCP:REP 17->66|1yqhA1|4e-05|28.0|50/101|d.58.48.1| RP:SCP:REP 110->181|2avnA1|5e-13|42.3|71/246|c.66.1.41| HM:SCP:REP 1->114|1s7hA_|1.5e-27|42.0|112/186|d.58.48.2|1/1|MTH1187/YkoF-like| HM:SCP:REP 96->228|1vl5A_|2.4e-30|45.9|133/0|c.66.1.41|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 30 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ---------------11-----------------------------------------------------------------------------------------1-------------------11-1-1----------------------------------2-------------------11------11111------1--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------1-----------------------1-----------------------------------------------------1--------------------------------------------------------1----------------------------------1--------------1-------------------------22--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 84.7 SQ:SECSTR HHHHTTGGGHHHHHHHcccccccEEETTcTTcHHHHHHcccEEEEEEccHHHHHccGGGGGTcccccHHHHGGGccHHHHETTcccHHHHHHHHHHHHHHHHHccTTcEEEETTcTTcHHHHHHHHHTcEEEEEEccTHHHHHHHHHHHHEEEEEcGGGTHHHHcccEEEEEEccccTTccTHHHHHHcEEEEEEEEEEEEcccccccccc###################################### DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHcccccHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccEEEEEcccHHHHHHHHHHccccEEEEccHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccccccccHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHccc //