[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80462.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.306.1
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->41 2a6qB PDBj 1e-06 19.5 %
:RPS:SCOP  1->41 2a6qB1  d.306.1.1 * 2e-07 19.5 %
:HMM:SCOP  1->51 2odkA1 d.306.1.1 * 4.2e-10 45.1 %
:HMM:PFM   1->43 PF02604 * PhdYeFM 6.8e-15 48.8 43/75  
:BLT:SWISS 1->46 Y3441_MYCBO 8e-04 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80462.1 GT:GENE AAS80462.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(102035..102265) GB:FROM 102035 GB:TO 102265 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80462.1 GB:DB_XREF GI:46196044 LENGTH 76 SQ:AASEQ MKAFTVHQAKTHLSRLLKAVEEGEEVVILRGKTPVARLVPYRKGKRPLGFVPGRLPESFFEPLPEEELALWEGATS GT:EXON 1|1-76:0| BL:SWS:NREP 1 BL:SWS:REP 1->46|Y3441_MYCBO|8e-04|34.8|46/99| SEG 55->68|lpesffeplpeeel| RP:PDB:NREP 1 RP:PDB:REP 1->41|2a6qB|1e-06|19.5|41/58| HM:PFM:NREP 1 HM:PFM:REP 1->43|PF02604|6.8e-15|48.8|43/75|PhdYeFM| RP:SCP:NREP 1 RP:SCP:REP 1->41|2a6qB1|2e-07|19.5|41/55|d.306.1.1| HM:SCP:REP 1->51|2odkA1|4.2e-10|45.1|51/0|d.306.1.1|1/1|YefM-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 63.2 SQ:SECSTR ccEEEHHHHHHHHHHHHHHHHHTccEEEEccccccEEEccHHHHHHHH############################ DISOP:02AL 41-51, 75-76| PSIPRED cccccHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEEEEccccccccccccccccccccccccHHHHHHcccccc //