[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80466.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->53 PF11239 * DUF3040 0.00032 31.1 45/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80466.1 GT:GENE AAS80466.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 104984..105292 GB:FROM 104984 GB:TO 105292 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80466.1 GB:DB_XREF GI:46196048 LENGTH 102 SQ:AASEQ MAERARKKVPEPFPGAYYLAGAITVALMLLFLALGASLPPGVAGFLVAFVLGLTVSPRYVPFFLLAGVFSAVMGFLGREPQVAWGGVALVLSQLVVRRFVKD GT:EXON 1|1-102:0| TM:NTM 2 TM:REGION 24->46| TM:REGION 58->80| SEG 26->38|almllflalgasl| HM:PFM:NREP 1 HM:PFM:REP 9->53|PF11239|0.00032|31.1|45/82|DUF3040| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10| PSIPRED ccccHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc //