[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80467.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->94 PF04246 * RseC_MucC 0.00026 39.5 43/135  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80467.1 GT:GENE AAS80467.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 105295..105591 GB:FROM 105295 GB:TO 105591 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80467.1 GB:DB_XREF GI:46196049 LENGTH 98 SQ:AASEQ MGPDRLSQALSLLGIAGYVYFLWFRPNQEGLALALGLALGGAAVAYGERPFLVPLFAVLYGGILFLQLFYGHPWAFLLGGLLGAGLPYALYRLRKPRR GT:EXON 1|1-98:0| TM:NTM 4 TM:REGION 1->22| TM:REGION 30->46| TM:REGION 50->71| TM:REGION 73->92| SEG 30->43|glalalglalggaa| SEG 77->93|llggllgaglpyalyrl| HM:PFM:NREP 1 HM:PFM:REP 51->94|PF04246|0.00026|39.5|43/135|RseC_MucC| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 97-98| PSIPRED ccHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHccccc //