[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80488.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->100 2cz4A PDBj 1e-52 99.0 %
:RPS:PDB   2->100 2cz4A PDBj 1e-13 99.0 %
:RPS:SCOP  2->100 2cz4A1  d.58.5.1 * 4e-39 99.0 %
:HMM:SCOP  1->100 2cz4A1 d.58.5.1 * 2.4e-23 31.0 %
:HMM:PFM   9->99 PF04422 * FrhB_FdhB_N 0.00063 28.6 49/82  
:BLT:SWISS 5->99 Y1513_SYNY3 4e-07 35.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80488.1 GT:GENE AAS80488.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 124512..124814 GB:FROM 124512 GB:TO 124814 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80488.1 GB:DB_XREF GI:46196070 LENGTH 100 SQ:AASEQ MELVPLKLVTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGSRGIRSVDWEGQNIRLETIVSEEVALRILQRLQEEYFPHYAVIAYVENVWVVRGEKYV GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 5->99|Y1513_SYNY3|4e-07|35.9|92/100| BL:PDB:NREP 1 BL:PDB:REP 2->100|2cz4A|1e-52|99.0|99/99| RP:PDB:NREP 1 RP:PDB:REP 2->100|2cz4A|1e-13|99.0|99/99| HM:PFM:NREP 1 HM:PFM:REP 9->99|PF04422|0.00063|28.6|49/82|FrhB_FdhB_N| RP:SCP:NREP 1 RP:SCP:REP 2->100|2cz4A1|4e-39|99.0|99/100|d.58.5.1| HM:SCP:REP 1->100|2cz4A1|2.4e-23|31.0|100/0|d.58.5.1|1/1|GlnB-like| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------1 ----------------------------------------------------------------------------------------------------------------------------------------11111-----211---1------------------------------1--11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 99.0 SQ:SECSTR #cEEEEEEEEEEEEGGGHHHHHHHHHHHTccccEEEEcccTTcccTTcEEEcccEEEEEEEEccHHHHHHHHHHHHHHTTTccEEEEEEEEEEcccGGGc DISOP:02AL 1-2| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEcEEEEccEEcc //