[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80507.1
DDBJ      :             riboflavin kinase/FMN adenylyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  847/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
b.43.5c.26.1
:294 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->275 1s4mA PDBj 2e-26 37.7 %
:RPS:PDB   14->159 1cozA PDBj 4e-15 18.7 %
:RPS:PDB   167->275 3bnwA PDBj 7e-29 25.0 %
:RPS:SCOP  15->173 1mrzA2  c.26.1.3 * 2e-17 31.2 %
:RPS:SCOP  187->272 1mrzA1  b.43.5.1 * 1e-23 38.3 %
:HMM:SCOP  15->173 1mrzA2 c.26.1.3 * 3.6e-28 38.7 %
:HMM:SCOP  160->293 1n08A_ b.43.5.1 * 2.5e-43 50.7 %
:RPS:PFM   13->153 PF06574 * FAD_syn 3e-18 39.7 %
:RPS:PFM   171->275 PF01687 * Flavokinase 2e-21 51.4 %
:HMM:PFM   170->292 PF01687 * Flavokinase 2.2e-39 43.1 123/125  
:HMM:PFM   13->146 PF06574 * FAD_syn 1.3e-37 43.3 134/158  
:BLT:SWISS 6->294 RIBF_SHIFL 4e-39 34.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80507.1 GT:GENE AAS80507.1 GT:PRODUCT riboflavin kinase/FMN adenylyltransferase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(141650..142534) GB:FROM 141650 GB:TO 142534 GB:DIRECTION - GB:PRODUCT riboflavin kinase/FMN adenylyltransferase GB:PROTEIN_ID AAS80507.1 GB:DB_XREF GI:46196089 LENGTH 294 SQ:AASEQ MLFSEVADVPKGPKVVAVGSFDGVHLGHQYLLRQALAEAKALHQPLLVYTFDPPTKVFTRGEGFLMDLTEKVEALRALGVELILAVPFNETFARRPAEEFLEDLRTLGASRIYVGEDFRFGRGRGGDPEALARVAPTRVVPLLALGGEPVKSSRIRALLQEGRVEEARHLLGRPYGAYGVVVEGEKLGRRLSFPTANLAVHPLKVLPPGVYAVEAMGDFGRYKGVANVGTRPTLGGGERRLEVHLLGFAGELYGEEVRLLFLKHLRQERRFESLEALKAQIAQDVAAARAYFGL GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 6->294|RIBF_SHIFL|4e-39|34.6|289/313| SEG 118->126|frfgrgrgg| SEG 276->290|alkaqiaqdvaaara| BL:PDB:NREP 1 BL:PDB:REP 15->275|1s4mA|2e-26|37.7|247/277| RP:PDB:NREP 2 RP:PDB:REP 14->159|1cozA|4e-15|18.7|123/126| RP:PDB:REP 167->275|3bnwA|7e-29|25.0|104/160| RP:PFM:NREP 2 RP:PFM:REP 13->153|PF06574|3e-18|39.7|141/157|FAD_syn| RP:PFM:REP 171->275|PF01687|2e-21|51.4|105/125|Flavokinase| HM:PFM:NREP 2 HM:PFM:REP 170->292|PF01687|2.2e-39|43.1|123/125|Flavokinase| HM:PFM:REP 13->146|PF06574|1.3e-37|43.3|134/158|FAD_syn| GO:PFM:NREP 4 GO:PFM GO:0003919|"GO:FMN adenylyltransferase activity"|PF06574|IPR015864| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF06574|IPR015864| GO:PFM GO:0008531|"GO:riboflavin kinase activity"|PF01687|IPR015865| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF01687|IPR015865| RP:SCP:NREP 2 RP:SCP:REP 15->173|1mrzA2|2e-17|31.2|154/157|c.26.1.3| RP:SCP:REP 187->272|1mrzA1|1e-23|38.3|81/109|b.43.5.1| HM:SCP:REP 15->173|1mrzA2|3.6e-28|38.7|150/0|c.26.1.3|1/1|Nucleotidylyl transferase| HM:SCP:REP 160->293|1n08A_|2.5e-43|50.7|134/154|b.43.5.1|1/1|Riboflavin kinase-like| OP:NHOMO 870 OP:NHOMOORG 852 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111-1211-11111-11111111----11-111111111111111111---1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111121221111111111212111212112222221111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11-1111-1--1111111111111111111111111111111111-111111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111--------2-1-1---------11------1--1111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------11-1----------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 91.8 SQ:SECSTR #####HHHHHTTccEEEEEEcccccHHHHHHHHHHHHHccEEEEEEEEEEcccGGGccTTccGGcccHHHHHHHHHTTTccEEEcccHHHHccTTcccccccccHHHHHHHHHcccEEEEEGGGHHHHHHHHHcEEEEEcccccTTcccccGGGGGHTccHHHHHHcccTTcccEEEEEEEEcccccHHHccccccEEcccHHHHHHHEEEEEEEEEEEETTEEEEEEEEEEEEEccccEEEEEEcccccccTTcEEEEEEEEEEEEccccccHH################### PSIPRED cEEccHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHcccccccccHHHHHHHHHHccccEEEEEcccHHHHcccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHccEEEEEEEEEccEEEcHHHHHHHHHcccHHHHHHHcccccEEEEEEEccccccccccccEEEEccccccccccccEEEEEEEccEEEEEEEEEccccEEcccEEEEEEEEEcccccccccEEEEEEEEEHHcccccccHHHHHHHHHHHHHHHHHHHcc //