[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80511.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:275 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  230->275 1s7bA  f.39.1.1 * 9e-06 26.1 %
:HMM:SCOP  41->145 1s7bA_ f.39.1.1 * 2.4e-06 26.7 %
:HMM:SCOP  177->275 1s7bA_ f.39.1.1 * 1.6e-14 39.4 %
:HMM:PFM   18->137 PF00892 * EamA 3.6e-10 23.3 120/126  
:HMM:PFM   173->273 PF00892 * EamA 1.8e-15 32.7 101/126  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80511.1 GT:GENE AAS80511.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(143879..144706) GB:FROM 143879 GB:TO 144706 GB:DIRECTION - GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS80511.1 GB:DB_XREF GI:46196093 LENGTH 275 SQ:AASEQ MDASLLLPLGFGLLSALTWGAGDFGGGMASRRAHAQAVVLWASGIGLLLFLLLAQVFGEAPQGRDLPYALLGGASGALGLLAFYRALAQGEMGLAAPVAGVVGAALPVALGALLEGWPGLFPALGMGLGLLAVWLVSRPEGRARPGNLGLALLAGLGFGGFYAFMDRVEGLFYPAAWAKLTAFLLVLPAALRARPWPGGREAPWVLLAGLGDAGGNLFFLLAAQAGRLDVAAVLSSFYPVFTVLLAWLVLKERLSRRRLTGVGLSLLAMALIALG GT:EXON 1|1-275:0| TM:NTM 10 TM:REGION 4->26| TM:REGION 36->58| TM:REGION 64->86| TM:REGION 92->114| TM:REGION 119->140| TM:REGION 149->169| TM:REGION 171->192| TM:REGION 201->223| TM:REGION 230->251| TM:REGION 259->275| SEG 3->17|aslllplgfgllsal| SEG 47->53|lllflll| SEG 69->82|allggasgalglla| SEG 93->114|glaapvagvvgaalpvalgall| SEG 148->164|lglallaglgfggfyaf| SEG 182->195|afllvlpaalrarp| SEG 206->226|llaglgdaggnlffllaaqag| HM:PFM:NREP 2 HM:PFM:REP 18->137|PF00892|3.6e-10|23.3|120/126|EamA| HM:PFM:REP 173->273|PF00892|1.8e-15|32.7|101/126|EamA| RP:SCP:NREP 1 RP:SCP:REP 230->275|1s7bA|9e-06|26.1|46/106|f.39.1.1| HM:SCP:REP 41->145|1s7bA_|2.4e-06|26.7|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 177->275|1s7bA_|1.6e-14|39.4|99/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------1------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //