[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80520.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  188/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:336 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   138->257 3ix7B PDBj 6e-48 98.3 %
:RPS:PDB   144->257 3dboB PDBj 3e-08 12.8 %
:RPS:SCOP  144->257 1o4wA  c.120.1.1 * 2e-12 20.0 %
:HMM:SCOP  139->266 1o4wA_ c.120.1.1 * 6e-20 37.8 %
:RPS:PFM   134->188 PF05626 * DUF790 2e-04 40.0 %
:HMM:PFM   144->255 PF01850 * PIN 2.4e-08 28.7 101/126  
:HMM:PFM   268->318 PF01938 * TRAM 7.1e-07 30.6 49/61  
:HMM:PFM   85->142 PF04156 * IncA 3.6e-05 25.9 58/191  
:BLT:SWISS 244->336 YSC1_THETH 2e-38 97.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80520.1 GT:GENE AAS80520.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(153181..154191) GB:FROM 153181 GB:TO 154191 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80520.1 GB:DB_XREF GI:46196102 LENGTH 336 SQ:AASEQ MKTRHLVYLAFALLGLGLAGLLEDWGLLPQSPSLLSLNRLYLALAGLLTGLLLGPRLEGALEARLKRLRNLPPEVVVAATLGSTVGLLLAVLLTTLLAQVPGFSPVHSLLLALGLVALFIYLALGYRAYFRLPEPKPAPQGGKVLDTSVLVDGRVAEVAAVGFLEGPLWVPHFVLKELQHFADSQDPLRRAKGRRGLETLERLREAAPLEVLEATPKGESVDEKLLFLARDLEAALVTNDHALLQMARIYGVKALSIQALAQALRPQLQVGDTLKLLILKEGKEPHQGVGYLEDGSMVVVDGGSRYRGQEIEVVVTQAIQTQVGRLFFARPAQGAQ GT:EXON 1|1-336:0| BL:SWS:NREP 1 BL:SWS:REP 244->336|YSC1_THETH|2e-38|97.8|93/93| TM:NTM 4 TM:REGION 5->26| TM:REGION 36->58| TM:REGION 74->96| TM:REGION 107->129| SEG 6->57|lvylafallglglaglledwgllpqspsllslnrlylalaglltglllgprl| SEG 78->98|aatlgstvglllavllttlla| SEG 109->118|lllalglval| SEG 194->214|rrgletlerlreaaplevlea| SEG 258->269|qalaqalrpqlq| BL:PDB:NREP 1 BL:PDB:REP 138->257|3ix7B|6e-48|98.3|119/129| RP:PDB:NREP 1 RP:PDB:REP 144->257|3dboB|3e-08|12.8|109/126| RP:PFM:NREP 1 RP:PFM:REP 134->188|PF05626|2e-04|40.0|50/382|DUF790| HM:PFM:NREP 3 HM:PFM:REP 144->255|PF01850|2.4e-08|28.7|101/126|PIN| HM:PFM:REP 268->318|PF01938|7.1e-07|30.6|49/61|TRAM| HM:PFM:REP 85->142|PF04156|3.6e-05|25.9|58/191|IncA| RP:SCP:NREP 1 RP:SCP:REP 144->257|1o4wA|2e-12|20.0|105/125|c.120.1.1| HM:SCP:REP 139->266|1o4wA_|6e-20|37.8|119/125|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 188 OP:NHOMOORG 188 OP:PATTERN -------------------------------------------------------------------- -11-------------------------------------1-----------------------------------------------------------------------------------1-----------11111---1111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111-1-11-1---111111111---111---------------------------------------------1111111111111111111111-1-111--111111111111111-1---11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 35.7 SQ:SECSTR #########################################################################################################################################cccccEEEccGGGcccccGGHHHHcGcccEEEEEHHHHHHHHHHHHHcccHHHHHHHHHHHHTTTTccEEcccHHHHHHHHHHHHHHHHHHHHHTTccEEEccccGGGGTTcTTccEEEc############################################################################### DISOP:02AL 1-2, 136-139, 333-336| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccEEEcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcHHHHHHHHHccccccEEEHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccEEEEcHHHHHHHHHHHcccEEEccHHHHHccccEEccccEEEEEEEccccccccEEEccccEEEEEcccHHccccEEEEEEEEEEEEcccEEEEEEcccccc //