[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80529.1
DDBJ      :             glutaminyl-tRNA synthetase
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  617/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
b.53.1c.26.1
:548 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->544 2hz7A PDBj e-157 53.0 %
:RPS:PDB   26->397 2cfoB PDBj 6e-31 19.1 %
:RPS:SCOP  26->340 1g59A2  c.26.1.1 * 7e-60 24.5 %
:RPS:SCOP  338->544 1euqA1  b.53.1.2 * 3e-37 44.9 %
:HMM:SCOP  6->337 1gtrA2 c.26.1.1 * 2.1e-91 37.7 %
:HMM:SCOP  338->545 1gtrA1 b.53.1.2 * 3.7e-65 49.3 %
:RPS:PFM   27->308 PF00749 * tRNA-synt_1c 4e-26 38.5 %
:RPS:PFM   338->522 PF03950 * tRNA-synt_1c_C 2e-35 53.4 %
:HMM:PFM   24->335 PF00749 * tRNA-synt_1c 6.4e-103 39.7 305/314  
:HMM:PFM   338->525 PF03950 * tRNA-synt_1c_C 6.3e-50 47.1 170/173  
:BLT:SWISS 5->544 SYQ_YERE8 e-154 52.0 %
:PROS 31->42|PS00178|AA_TRNA_LIGASE_I
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80529.1 GT:GENE AAS80529.1 GT:PRODUCT glutaminyl-tRNA synthetase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(162273..163919) GB:FROM 162273 GB:TO 163919 GB:DIRECTION - GB:PRODUCT glutaminyl-tRNA synthetase GB:PROTEIN_ID AAS80529.1 GB:DB_XREF GI:46196111 LENGTH 548 SQ:AASEQ MGLVPECFITEIVEQDLKEGKYAKLVTRFPPEPNGYLHIGHARSIVLNFGLAQDYGGECNLRFDDTNPETEKEEYARAIEEDVRWLGFQPTRVLYASDYFETMYQCALVLIQEGKAYVDDLPEEEMSELRAQGKPSPYRERSVEENLELFERMRRGEFPTGSRVLRAKIDPAHPNFKLRDPVLYRIVHAPHYHAGNKWVIYPMYDFAHPLEDFIEGVTHSLCTLEFENNRAVYDWVIENLKGKCGLPTSPRPHQYEFARLDLSHTVLSKRKLIKLVEGGYVSGWDDPRLPTLRGLRRRGVRPEAIVEFVRKTGISRNEAQIEMDLFEEVVRDDLNPIAPRVLGVVDPLRVVLTNYEGEEWIEAPYWPRDIPKEGTRPLPFSPELYIERTDFSLNPPKGWKRLAPGQRVRLRHAYVIELEDVVEEGGEVKLLKARIVPGTLGANPEDGVRPKGVIHWVSARHALPVEFRLYGRLFRTKDPEEGGDFLQNLNPEALVVKRGFIEPSVAQDPEDTRYQLERLGYFWRDPVDSRPEALVMNRIVPLKEGYRV GT:EXON 1|1-548:0| BL:SWS:NREP 1 BL:SWS:REP 5->544|SYQ_YERE8|e-154|52.0|533/555| PROS 31->42|PS00178|AA_TRNA_LIGASE_I|PDOC00161| SEG 287->302|prlptlrglrrrgvrp| SEG 417->432|eledvveeggevkllk| BL:PDB:NREP 1 BL:PDB:REP 3->544|2hz7A|e-157|53.0|528/556| RP:PDB:NREP 1 RP:PDB:REP 26->397|2cfoB|6e-31|19.1|366/487| RP:PFM:NREP 2 RP:PFM:REP 27->308|PF00749|4e-26|38.5|273/309|tRNA-synt_1c| RP:PFM:REP 338->522|PF03950|2e-35|53.4|178/186|tRNA-synt_1c_C| HM:PFM:NREP 2 HM:PFM:REP 24->335|PF00749|6.4e-103|39.7|305/314|tRNA-synt_1c| HM:PFM:REP 338->525|PF03950|6.3e-50|47.1|170/173|tRNA-synt_1c_C| GO:PFM:NREP 12 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00749|IPR020058| GO:PFM GO:0005524|"GO:ATP binding"|PF00749|IPR020058| GO:PFM GO:0005737|"GO:cytoplasm"|PF00749|IPR020058| GO:PFM GO:0006412|"GO:translation"|PF00749|IPR020058| GO:PFM GO:0016876|"GO:ligase activity, forming aminoacyl-tRNA and related compounds"|PF00749|IPR020058| GO:PFM GO:0043039|"GO:tRNA aminoacylation"|PF00749|IPR020058| GO:PFM GO:0000166|"GO:nucleotide binding"|PF03950|IPR020059| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF03950|IPR020059| GO:PFM GO:0005524|"GO:ATP binding"|PF03950|IPR020059| GO:PFM GO:0005737|"GO:cytoplasm"|PF03950|IPR020059| GO:PFM GO:0006412|"GO:translation"|PF03950|IPR020059| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF03950|IPR020059| RP:SCP:NREP 2 RP:SCP:REP 26->340|1g59A2|7e-60|24.5|286/305|c.26.1.1| RP:SCP:REP 338->544|1euqA1|3e-37|44.9|196/198|b.53.1.2| HM:SCP:REP 6->337|1gtrA2|2.1e-91|37.7|326/331|c.26.1.1|1/1|Nucleotidylyl transferase| HM:SCP:REP 338->545|1gtrA1|3.7e-65|49.3|207/209|b.53.1.2|1/1|Ribosomal protein L25-like| OP:NHOMO 1547 OP:NHOMOORG 881 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 2211-----------------------------------------1-----------------1---11---------1-1111111111111111-111111111-111------------------------1----1------11--11111--1---11111-1111-1111111-11121111-----------1------1------------------------12------------------1------------11-----11---1111-1-111-11----------------------------------311-11111111----1111222111---112-1111121---11241--312-11-22222332323232222233333333332-22122122321-1111--1----1232112221111222111111111331211112211--12222221122222122122221112221222222222211111111111111111111112111111111111112221222222222222232212222221232222222222221222211212-221111111111111111111111112112221112222211111111111111111111-2211111111122222222222222222-222222222222222222222211221221222222222222212222222112111111111111121-----2222111112222222222222222221222112111111111111111111122222222222222222222223222222222222222122---------------1-11111--1-----1111---11-11-1-1112-212-12 2222222-72222222233233332333322223332222222222322222222223222322222222222222212222222222-22222222222222223223243422332221222231326G2-2362222322222222222262222236E22233313422222223r2223244573343332223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 543 STR:RPRED 99.1 SQ:SECSTR #TTccEEEcccccccccTTcEEcEEEEEEcccccccccHHHHHHHHHHHHHHHHTTcEEEEEEccccTTTccHHHHHHHHHHHHHHTcccEEEEEGGGcHHHHHHHHHHHHHHTcEEEEcccHHHHHHHHHHHHHTTcccccccTTTTccHHHHHHHHHTTcccEEEEcccTTcEEEEEETTTEEEEEEGGGGcccEEcccccHHHHHHHHHHHTTccEEEEEGGGTTHHHHHHHHHHHTTccHHHHHHccEEEEEccEEcTTcccccTTcccccHHHHHHTTccHHTTccccTTTcccccHHHHHHHccGGGcccccEEccHHHHHHHHHHcHHHHHHHHHHHHHHTTccccTTTcHHHHHHHHHHGGGcccTTHHHHHHHHHHcccccccHHHHHTcccEEEEEccTTccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHTTTTTccHcccHHHHHHHHHHHHHTTccccTTcccccEEEcccccccccccHHHHHHHHHTccccTTTEEEEEcccc#### DISOP:02AL 129-136| PSIPRED ccccccHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHccccEEccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccEEEEEEEccccccEEEccEEEEEEcccccccccccEEEEEHHccHHHHHHHHccccEEEEccccccccHHHHHHHHHcccccccccccccEEEEEEEEcccccEEEcHHHHcccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHccccccccccccEEEEEEccccccEEEEcccccccHHHccEEEEEccEEEEEEccccccccccHHHHccccEEEEcccEEEEEEEEEcccccEEEEEEEEccccccccccccccccEEEEEEcccccEEEEEEEcccccccccccccccHHHHcccccEEEEEEEEEHHHHHcccccEEEEEEEEEEEEcccccccccEEEEEEEcccccccc //