[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80533.1
DDBJ      :             LSU ribosomal protein L20P
Swiss-Prot:RL20_THET8   RecName: Full=50S ribosomal protein L20;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
a.144.2
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->118 2j01U PDBj 2e-58 100.0 %
:RPS:PDB   1->117 3bboS PDBj 1e-30 33.3 %
:RPS:SCOP  3->116 1vs6Q1  a.144.2.1 * 8e-33 54.4 %
:HMM:SCOP  61->120 1gyzA_ a.144.2.1 * 2e-23 56.7 %
:RPS:PFM   3->109 PF00453 * Ribosomal_L20 8e-19 49.5 %
:HMM:PFM   3->109 PF00453 * Ribosomal_L20 9.6e-48 59.8 107/108  
:BLT:SWISS 1->118 RL20_THET8 2e-58 100.0 %
:PROS 54->70|PS00937|RIBOSOMAL_L20
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80533.1 GT:GENE AAS80533.1 GT:PRODUCT LSU ribosomal protein L20P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 165606..165962 GB:FROM 165606 GB:TO 165962 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L20P GB:PROTEIN_ID AAS80533.1 GB:DB_XREF GI:46196115 LENGTH 118 SQ:AASEQ MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQG GT:EXON 1|1-118:0| SW:ID RL20_THET8 SW:DE RecName: Full=50S ribosomal protein L20; SW:GN Name=rplT; OrderedLocusNames=TTHA0553; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->118|RL20_THET8|2e-58|100.0|118/118| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 54->70|PS00937|RIBOSOMAL_L20|PDOC00722| SEG 50->59|rkrrkrdfrr| BL:PDB:NREP 1 BL:PDB:REP 2->118|2j01U|2e-58|100.0|117/117| RP:PDB:NREP 1 RP:PDB:REP 1->117|3bboS|1e-30|33.3|117/119| RP:PFM:NREP 1 RP:PFM:REP 3->109|PF00453|8e-19|49.5|107/108|Ribosomal_L20| HM:PFM:NREP 1 HM:PFM:REP 3->109|PF00453|9.6e-48|59.8|107/108|Ribosomal_L20| GO:PFM:NREP 5 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00453|IPR005813| GO:PFM GO:0005622|"GO:intracellular"|PF00453|IPR005813| GO:PFM GO:0005840|"GO:ribosome"|PF00453|IPR005813| GO:PFM GO:0006412|"GO:translation"|PF00453|IPR005813| GO:PFM GO:0019843|"GO:rRNA binding"|PF00453|IPR005813| RP:SCP:NREP 1 RP:SCP:REP 3->116|1vs6Q1|8e-33|54.4|114/117|a.144.2.1| HM:SCP:REP 61->120|1gyzA_|2e-23|56.7|60/60|a.144.2.1|1/1|Ribosomal protein L20| OP:NHOMO 981 OP:NHOMOORG 961 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----2------------------------------------------------------------------------------------------------------11111111--1----1-11-1-122---1---11111-1----1--2-1---------1--11---22-1217111111222-141111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 100.0 SQ:SECSTR ccccccTTHHHHHHHHHHHHcccccccTTccHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHTcccccccGGGGTTccTTTTTHHHHHHHHHcc DISOP:02AL 118-119| PSIPRED cccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHcc //