[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80534.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:RPS:PFM   21->111 PF06695 * Sm_multidrug_ex 4e-07 35.6 %
:HMM:PFM   19->140 PF06695 * Sm_multidrug_ex 1.7e-39 50.4 121/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80534.1 GT:GENE AAS80534.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 166005..166475 GB:FROM 166005 GB:TO 166475 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80534.1 GB:DB_XREF GI:46196116 LENGTH 156 SQ:AASEQ MPFPPEVYVLLVAALPVVELRGAIPLGVALGLSPWESFLWALLGNLLVVPLALGLLPWAVGLATRMPLFARAWRALEVRVRLKGEAQVQRLGALGLFLFVAVPLPGTGAWSGAVLAVVLGVRRRYAFPALALGVVAAGLLVLLLTGGTVYGLNYLR GT:EXON 1|1-156:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 39->61| TM:REGION 86->107| TM:REGION 129->151| SEG 4->20|ppevyvllvaalpvvel| SEG 39->63|lwallgnllvvplalgllpwavgla| SEG 112->124|gavlavvlgvrrr| SEG 129->149|alalgvvaagllvllltggtv| RP:PFM:NREP 1 RP:PFM:REP 21->111|PF06695|4e-07|35.6|90/121|Sm_multidrug_ex| HM:PFM:NREP 1 HM:PFM:REP 19->140|PF06695|1.7e-39|50.4|121/121|Sm_multidrug_ex| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------11----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccHHHHHHHHHHccHHHHccccEEEEEEcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHccccccc //