[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80537.1
DDBJ      :             superoxide dismutase (Mn)
Swiss-Prot:SODM_THET8   RecName: Full=Superoxide dismutase [Mn];         EC=1.15.1.1;

Homologs  Archaea  39/68 : Bacteria  770/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
a.2.11d.352.1d.44.1
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->204 1mngA PDBj e-124 100.0 %
:RPS:PDB   5->204 2bpiA PDBj 6e-77 40.1 %
:RPS:SCOP  7->118 2hc5A1  d.352.1.1 * 6e-30 15.8 %
:RPS:SCOP  95->204 1ap5A2  d.44.1.1 * 2e-31 50.9 %
:HMM:SCOP  3->93 1gv3A1 a.2.11.1 * 2.3e-35 54.9 %
:HMM:SCOP  97->204 1y67A2 d.44.1.1 * 6.2e-44 61.7 %
:RPS:PFM   5->92 PF00081 * Sod_Fe_N 5e-19 59.3 %
:RPS:PFM   98->199 PF02777 * Sod_Fe_C 7e-42 67.6 %
:HMM:PFM   98->200 PF02777 * Sod_Fe_C 1.1e-46 61.2 103/106  
:HMM:PFM   5->91 PF00081 * Sod_Fe_N 7.4e-33 53.8 80/82  
:BLT:SWISS 1->204 SODM_THET8 e-124 100.0 %
:PROS 167->174|PS00088|SOD_MN

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80537.1 GT:GENE AAS80537.1 GT:PRODUCT superoxide dismutase (Mn) GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(168831..169445) GB:FROM 168831 GB:TO 169445 GB:DIRECTION - GB:PRODUCT superoxide dismutase (Mn) GB:PROTEIN_ID AAS80537.1 GB:DB_XREF GI:46196119 LENGTH 204 SQ:AASEQ MPYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA GT:EXON 1|1-204:0| SW:ID SODM_THET8 SW:DE RecName: Full=Superoxide dismutase [Mn]; EC=1.15.1.1; SW:GN Name=sodA; OrderedLocusNames=TTHA0557; SW:KW 3D-structure; Complete proteome; Direct protein sequencing; Manganese;Metal-binding; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->204|SODM_THET8|e-124|100.0|204/204| GO:SWS:NREP 3 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 167->174|PS00088|SOD_MN|PDOC00083| BL:PDB:NREP 1 BL:PDB:REP 2->204|1mngA|e-124|100.0|203/203| RP:PDB:NREP 1 RP:PDB:REP 5->204|2bpiA|6e-77|40.1|192/197| RP:PFM:NREP 2 RP:PFM:REP 5->92|PF00081|5e-19|59.3|81/82|Sod_Fe_N| RP:PFM:REP 98->199|PF02777|7e-42|67.6|102/104|Sod_Fe_C| HM:PFM:NREP 2 HM:PFM:REP 98->200|PF02777|1.1e-46|61.2|103/106|Sod_Fe_C| HM:PFM:REP 5->91|PF00081|7.4e-33|53.8|80/82|Sod_Fe_N| GO:PFM:NREP 8 GO:PFM GO:0004784|"GO:superoxide dismutase activity"|PF00081|IPR019831| GO:PFM GO:0006801|"GO:superoxide metabolic process"|PF00081|IPR019831| GO:PFM GO:0046872|"GO:metal ion binding"|PF00081|IPR019831| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00081|IPR019831| GO:PFM GO:0004784|"GO:superoxide dismutase activity"|PF02777|IPR019832| GO:PFM GO:0006801|"GO:superoxide metabolic process"|PF02777|IPR019832| GO:PFM GO:0046872|"GO:metal ion binding"|PF02777|IPR019832| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02777|IPR019832| RP:SCP:NREP 2 RP:SCP:REP 7->118|2hc5A1|6e-30|15.8|101/109|d.352.1.1| RP:SCP:REP 95->204|1ap5A2|2e-31|50.9|110/115|d.44.1.1| HM:SCP:REP 3->93|1gv3A1|2.3e-35|54.9|91/102|a.2.11.1|1/1|Fe,Mn superoxide dismutase (SOD), N-terminal domain| HM:SCP:REP 97->204|1y67A2|6.2e-44|61.7|107/0|d.44.1.1|1/1|Fe,Mn superoxide dismutase (SOD), C-terminal domain| OP:NHOMO 1480 OP:NHOMOORG 1000 OP:PATTERN 11----1111111111-111111-12221221--1--------2--111-111--------111--12 111--11111111121111-1-1112111111-1111211-111112-111111111111---11121211-----------111-111111-1111--112211312121111111111111111111111112111111--12121222221111----1111222231------------11111---122333333333333333322222333222111111111131122222222222222111111---11-----------1-----11111111111111111111111111111111111111111111111-1--2111111121211222111111--2--1122-111-1-1------1211122111111211111121212211111111112-111114111111133111111111211211111111111111111111111112111111111111111111111111111111-11211122221111111111111111111111111111-111111211211121111211121-1111111111112---1-31-1-111--1--111----1-12121111111111111111111112---112211111211111111111111111111111-1111111-11121111212222222222-222222222222222222222211212222222222222222222222222112222222222221111111111111211211111111111111111111113111122222222212222122211111111111112222222222233232333332222---111----11111111--11112-----------------------1-------121 2211121-B44-8B22222222222122222221111111111222112222223322222221211111112121111112221122-3532223111111221211242131112111-131111115A3-3141-1111211111--2111111121112311111331233367171116633862732342212 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 100.0 SQ:SECSTR cccccccccccccTTTTTTTccHHHHHHHHHTHHHHHHHHHHHHHTTcTTTTcccHHHHTTcHHHHHHHccHHHHHHHHHHHHHHHHHHTccTTccccccTHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEEcTTccEEEEEEETTccHHHHTcEEEEEEEccGGGTHHHHTTcHHHHHHHHTTTccHHHHHHHHHHH DISOP:02AL 94-98| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEcccccccccccEEEEEEEHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcc //