[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80538.1
DDBJ      :             fumarate hydratase
Swiss-Prot:FUMC_THET2   RecName: Full=Fumarate hydratase class II;         Short=Fumarase C;         EC=4.2.1.2;

Homologs  Archaea  47/68 : Bacteria  752/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
a.127.1
:466 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->463 1vdkA PDBj 0.0 97.8 %
:RPS:PDB   3->462 3e04A PDBj e-122 50.9 %
:RPS:SCOP  4->459 1fuoA  a.127.1.1 * e-135 54.0 %
:HMM:SCOP  2->460 1yfmA_ a.127.1.1 * 2.3e-167 43.4 %
:RPS:PFM   14->331 PF00206 * Lyase_1 2e-59 48.3 %
:HMM:PFM   11->342 PF00206 * Lyase_1 2e-116 54.5 310/312  
:HMM:PFM   408->462 PF10415 * FumaraseC_C 1.9e-25 63.6 55/55  
:BLT:SWISS 1->466 FUMC_THET2 0.0 100.0 %
:PROS 317->326|PS00163|FUMARATE_LYASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80538.1 GT:GENE AAS80538.1 GT:PRODUCT fumarate hydratase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(169520..170920) GB:FROM 169520 GB:TO 170920 GB:DIRECTION - GB:PRODUCT fumarate hydratase GB:PROTEIN_ID AAS80538.1 GB:DB_XREF GI:46196120 LENGTH 466 SQ:AASEQ MEYRIERDTMGEVRVPADKYWGAQTQRSLENFRIGTDRFRMPLEIIRAYGMLKKAAARANLELGELPEEIAKAIIQAAEEVVQGKWDDHFPLVVFQTGSGTQTNMNVNEVIANRASEILGKPLGSKYVHPNDHVNRGQSSNDTFPTAMYVAVALALHQRLYPAVEGLIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKTTLAAVKEMEKGLYNLAIGGTAVGTGLNAHPRFGELVAKYLAEETGLPFRVAENRFAALAAHDELVNVMGAIRTLAGALMKIGNDVRWLASGPYAGIGEITIPANEPGSSIMPGKVNPTQVEALTMVVVRVYGNDHTVAFAGSQGNFQLNVYKPVMAYSTLESINLLADAVASFDAHLAQGIEPNLERIEEHLQKNPMLATALNKAIGYDKAAEIVKKALKEKKTLKQAALELGYLTEEEFDRIVVPMRLAKPHEGA GT:EXON 1|1-466:0| SW:ID FUMC_THET2 SW:DE RecName: Full=Fumarate hydratase class II; Short=Fumarase C; EC=4.2.1.2; SW:GN Name=fumC; OrderedLocusNames=TT_C0190; SW:KW Complete proteome; Cytoplasm; Lyase; Tricarboxylic acid cycle. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->466|FUMC_THET2|0.0|100.0|466/466| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0006099|"GO:tricarboxylic acid cycle"|Tricarboxylic acid cycle| PROS 317->326|PS00163|FUMARATE_LYASES|PDOC00147| SEG 68->80|eeiakaiiqaaee| SEG 420->442|kaaeivkkalkekktlkqaalel| BL:PDB:NREP 1 BL:PDB:REP 4->463|1vdkA|0.0|97.8|458/458| RP:PDB:NREP 1 RP:PDB:REP 3->462|3e04A|e-122|50.9|454/456| RP:PFM:NREP 1 RP:PFM:REP 14->331|PF00206|2e-59|48.3|290/302|Lyase_1| HM:PFM:NREP 2 HM:PFM:REP 11->342|PF00206|2e-116|54.5|310/312|Lyase_1| HM:PFM:REP 408->462|PF10415|1.9e-25|63.6|55/55|FumaraseC_C| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00206|IPR000362| RP:SCP:NREP 1 RP:SCP:REP 4->459|1fuoA|e-135|54.0|454/456|a.127.1.1| HM:SCP:REP 2->460|1yfmA_|2.3e-167|43.4|459/459|a.127.1.1|1/1|L-aspartase-like| OP:NHOMO 1572 OP:NHOMOORG 979 OP:PATTERN 1111--1211111112-111--1-111111121-111-11111------11111-----11111--11 1111122222322211111-11111211111111111246111112212222323111--11121132111-11111111111-1-1-2212-211--1322111111111-1-11-11111111---111---21111111111121122222122111112222222111111111111111111111--33555555453455555224443554123311111111131211111111111111122221112222-111221122111211----------------------------------------111----1--23------------22-----1-221---1112-1-22111111---211111221212123111112111122222222221-3323322231212222232214112221111311121121111111111111211111111111111111111111111111-11-111-111112222221111111121111112211212-2111-21122112222111---212222222111123212-2123-333322111211123221212-42242122222221222222211--122222111111112222212----11---1222-21111------22222222222222222-2222422222222222222222332242222222222222222222222222222222222222211211111111111121322222222222222222222-2122213333344423333233211111111111113222222221111111112221111---1332222--------1---------------------------11-2211111111 ----211-----1121111111111111111111111111111111111112221211111111321122223121121212122111-13111111111111221-1112121-111112--111111171-11111111111-1111111111111221-12112512712331-12S2221131-31311131113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 463 STR:RPRED 99.4 SQ:SECSTR HHEEEEEETTEEEEEETTccccHHHHHHHHHcccccGGGcccHHHHHHHHHHHHHHHHHGGGGTccHHHHHHHHHHHHHHHHTTccGGGccccccccTTcHHHHHHHHHHHHHHHHHHTTccTTccccccccccTTTccHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTTTcEEEEEETTEEEEEEEHHHHHHHHHHHHHHHHHHHHHTcTTTcEEcTTcTTTcccTTccTTHHHHHHHHHHHHHTcccEEcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHTGGGcEEcHHHHHHHHHHccGGGGGGHHHHcHHHHHHHHHHHHHHTccHHHHHHHHTcccHHHHHHHccGGGccccc### DISOP:02AL 463-466| PSIPRED ccccccccccccccccHHHHccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHccHHHHccccccc //