[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80547.1
DDBJ      :             acylphosphatase
Swiss-Prot:ACYP_THET8   RecName: Full=Acylphosphatase;         EC=3.6.1.7;AltName: Full=Acylphosphate phosphohydrolase;

Homologs  Archaea  39/68 : Bacteria  271/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
d.58.10
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->88 1ulrA PDBj 2e-47 100.0 %
:RPS:PDB   1->87 3br8A PDBj 2e-23 39.1 %
:RPS:SCOP  2->88 1ulrA  d.58.10.1 * 6e-25 100.0 %
:HMM:SCOP  1->89 1w2iA_ d.58.10.1 * 1.9e-28 56.2 %
:RPS:PFM   1->75 PF00708 * Acylphosphatase 1e-15 54.7 %
:HMM:PFM   3->86 PF00708 * Acylphosphatase 3.2e-30 54.8 84/91  
:BLT:SWISS 1->88 ACYP_THET8 2e-47 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80547.1 GT:GENE AAS80547.1 GT:PRODUCT acylphosphatase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(179172..179438) GB:FROM 179172 GB:TO 179438 GB:DIRECTION - GB:PRODUCT acylphosphatase GB:PROTEIN_ID AAS80547.1 GB:DB_XREF GI:46196129 LENGTH 88 SQ:AASEQ MPRLVALVKGRVQGVGYRAFAQKKALELGLSGYAENLPDGRVEVVAEGPKEALELFLHHLKQGPRLARVEAVEVQWGEEAGLKGFHVY GT:EXON 1|1-88:0| SW:ID ACYP_THET8 SW:DE RecName: Full=Acylphosphatase; EC=3.6.1.7;AltName: Full=Acylphosphate phosphohydrolase; SW:GN Name=acyP; OrderedLocusNames=TTHA0567; SW:KW 3D-structure; Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|ACYP_THET8|2e-47|100.0|88/88| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 2->88|1ulrA|2e-47|100.0|87/87| RP:PDB:NREP 1 RP:PDB:REP 1->87|3br8A|2e-23|39.1|87/90| RP:PFM:NREP 1 RP:PFM:REP 1->75|PF00708|1e-15|54.7|75/90|Acylphosphatase| HM:PFM:NREP 1 HM:PFM:REP 3->86|PF00708|3.2e-30|54.8|84/91|Acylphosphatase| RP:SCP:NREP 1 RP:SCP:REP 2->88|1ulrA|6e-25|100.0|87/87|d.58.10.1| HM:SCP:REP 1->89|1w2iA_|1.9e-28|56.2|89/0|d.58.10.1|1/1|Acylphosphatase/BLUF domain-like| OP:NHOMO 347 OP:NHOMOORG 333 OP:PATTERN 11----1111111111111121111--111-1-----------1--124111--12-1212---2--- 111--111111-11-1111-11--11111111111111111-11---1-------1------1-11111-1-----------1-1111-----------------1--1-----------------1-1-1--1-111111111111121111-1--111111---1111-------------11111-1--11-----------------11-1---111---1-----------------------------------1------------------------------------------------------------------1---------------111--------1-----1-1-----1-1---1-------------1--1-----1------------1111-11-----1---11-11---1--------------------------1-11--------------------------------1---11----------------1----------1-1--11--------------11----1-----------11---1-1---1-111-1-----11-1--1-111---------------------1-----111-1-1----1-----------1--1-11---1111------111111-11111111---111111111111111111111111---1111111111111111-11111-1-----------------------11111111-1---11--------1---------------------------------------11111111111111------------------1111111------------------------------------11--11111--- --------21-----111----1------1-------111111-------1----1--1---------------------------------1-1----1--------2------------------------------------------------------------------1---------1---1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEEcccccHHHHHHHHHHHTTcEEEEEEcTTccEEEEEEEcHHHHHHHHHHHHHccTTcEEEEEEEEEccccccccEEEc DISOP:02AL 88-89| PSIPRED cEEEEEEEEEEEEEEcHHHHHHHHHHHHccEEEEEEccccEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccEEc //