[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80551.1
DDBJ      :             probable small heat shock protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  66/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->128 3glaB PDBj 2e-11 35.5 %
:RPS:PDB   38->128 2byuA PDBj 2e-17 33.0 %
:RPS:SCOP  35->129 1wh0A  b.15.1.3 * 1e-15 17.9 %
:HMM:SCOP  6->135 1gmeA_ b.15.1.1 * 3.8e-22 34.6 %
:RPS:PFM   41->134 PF00011 * HSP20 1e-08 36.2 %
:HMM:PFM   42->128 PF00011 * HSP20 9.4e-16 26.4 87/102  
:BLT:SWISS 3->127 SP21_STIAU 1e-12 30.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80551.1 GT:GENE AAS80551.1 GT:PRODUCT probable small heat shock protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(189644..190054) GB:FROM 189644 GB:TO 190054 GB:DIRECTION - GB:PRODUCT probable small heat shock protein GB:PROTEIN_ID AAS80551.1 GB:DB_XREF GI:46196133 LENGTH 136 SQ:AASEQ MLERHDRLETLRKLKELQERIAELAYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPGVRPEDLELLEEGQRVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPATALPLKEA GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 3->127|SP21_STIAU|1e-12|30.4|125/188| BL:PDB:NREP 1 BL:PDB:REP 36->128|3glaB|2e-11|35.5|93/99| RP:PDB:NREP 1 RP:PDB:REP 38->128|2byuA|2e-17|33.0|91/101| RP:PFM:NREP 1 RP:PFM:REP 41->134|PF00011|1e-08|36.2|94/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 42->128|PF00011|9.4e-16|26.4|87/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 35->129|1wh0A|1e-15|17.9|95/134|b.15.1.3| HM:SCP:REP 6->135|1gmeA_|3.8e-22|34.6|130/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 90 OP:NHOMOORG 73 OP:PATTERN ------------------------------1-----------------1------------------- ----------------------------------------------------------------------1-----------3--111--------------------3------------------------------12----21------------------------------------1122221--1--------------------------------------------------------------------------------------------------------------------------------------------------------------1---1----1---1--------1-11---------11--------------------------1----1-------------------------------------------------------------------------------------------------------------------1---1-------------1-1---------111------11222---111--1-1121-11121--1-------------------------------------------------------------1111------------------------------------------------------------------------------------------------------1---------------------------------------------------------1----------------1-1--111--------------------------------------------------------------- ----------1---1-----------------------------------------------------------------------1----1--3-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 72.1 SQ:SECSTR ##############################ccccEEEccEEEEEcccEEEEEEEcTTccGGGEEEEETTTEEEEEEccccccccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEEcccc######## DISOP:02AL 1-3, 26-29, 126-136| PSIPRED cccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccEEEEEEEEccccHHEEEEEEEccEEEEEEEEEcccccEEEEEEEccEEEEEEEccccccccEEEEEEEccEEEEEEccccHHccccccc //