[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80557.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:566 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   204->286 PF06745 * KaiC 2e-04 38.5 %
:HMM:PFM   144->195 PF11072 * DUF2859 4.9e-05 37.3 51/142  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80557.1 GT:GENE AAS80557.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(195153..196853) GB:FROM 195153 GB:TO 196853 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80557.1 GB:DB_XREF GI:46196139 LENGTH 566 SQ:AASEQ MRALLHLLLFLALLPSLLALAPRLRAQAPGPVALVLDAEAVREEARARGEDLMAALARYQAFGVNGVAFPERLVRDWVGEGVLLYRQGRELVEMGLSARPGWHYLKGDPALLALLERAYDLPSERLGEWLGFPVDVQALPAFYNLEELRQAKAMGLYVMVRPLNHRLRRLEAGLPLVPKEADAVVFQGLEALGYPYRLGEAKALVPVPVALIEGTPQAGLGAFRDKGILRLFSLRYEWLLTLKPEEAAEKYGLAARERSHQILYLRPYPYPEDTARLLKRLQEELKASGLPLGAPSPRALAPSPLRYAAWVGVLAGLGLLALGLPVYGPLVAFLLLLFALGYAGSQAGPLLAALVFPVLGFLGPRNGLWMWARSLGYALLGAVFLSALGSTEEAIAGLAPFKGVSLTLLVPPLLVAYSFLEKDFKEALTRLFLHPARLGEVALGGLALGLLLLALLRRGNDAPIVPELELKLRALLQDVMVRPRFKEVFGHALFPLALLLPWPRWVQNGLLFLASLGIASILNTFSHYHTPLPISFFRVLNGALLGLSLGLVGVILVRRLRAWWSA GT:EXON 1|1-566:0| TM:NTM 9 TM:REGION 2->23| TM:REGION 51->73| TM:REGION 314->336| TM:REGION 344->366| TM:REGION 368->390| TM:REGION 397->419| TM:REGION 435->456| TM:REGION 496->518| TM:REGION 535->557| SEG 2->29|rallhlllflallpsllalaprlraqap| SEG 32->48|valvldaeavreearar| SEG 289->344|glplgapspralapsplryaawvgvlaglgllalglpvygplvafllllfalgyag| SEG 406->415|ltllvppllv| SEG 436->459|arlgevalgglalgllllallrrg| SEG 492->501|alfplalllp| SEG 538->561|rvlngallglslglvgvilvrrlr| RP:PFM:NREP 1 RP:PFM:REP 204->286|PF06745|2e-04|38.5|78/202|KaiC| HM:PFM:NREP 1 HM:PFM:REP 144->195|PF11072|4.9e-05|37.3|51/142|DUF2859| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-28,31-32,566-567| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHccccHHHHHHHHHHccccEEEcccHHHHHHccccEEEEEccHHHHHcccccccccEEEEcccHHHHHHHccccccHHHHHHHHcccccHHHccccccHHHHHHHHHcccEEEEEEccccccHHHHccccccccccEEEEccccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHccccEEEEEEcHHHHHcccHHHHHHHHcHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //