[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80558.1
DDBJ      :             uridine kinase
Swiss-Prot:URK_THET8    RecName: Full=Uridine kinase;         EC=2.7.1.48;AltName: Full=Uridine monophosphokinase;AltName: Full=Cytidine monophosphokinase;

Homologs  Archaea  9/68 : Bacteria  402/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->192 1udwA PDBj 7e-42 43.1 %
:RPS:PDB   2->190 1a7jA PDBj 1e-25 17.6 %
:RPS:SCOP  6->157 1rz3A  c.37.1.6 * 4e-34 25.2 %
:HMM:SCOP  4->199 1esmA_ c.37.1.6 * 4.1e-54 40.0 %
:RPS:PFM   8->185 PF00485 * PRK 2e-34 49.7 %
:HMM:PFM   8->191 PF00485 * PRK 1.5e-42 34.4 183/194  
:BLT:SWISS 1->192 URK_THET8 2e-99 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80558.1 GT:GENE AAS80558.1 GT:PRODUCT uridine kinase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(196850..197485) GB:FROM 196850 GB:TO 197485 GB:DIRECTION - GB:PRODUCT uridine kinase GB:PROTEIN_ID AAS80558.1 GB:DB_XREF GI:46196140 LENGTH 211 SQ:AASEQ MSAPKPFVIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAYTRSPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPRGGQNPVALEMLAAKALARLARMGAA GT:EXON 1|1-211:0| SW:ID URK_THET8 SW:DE RecName: Full=Uridine kinase; EC=2.7.1.48;AltName: Full=Uridine monophosphokinase;AltName: Full=Cytidine monophosphokinase; SW:GN Name=udk; OrderedLocusNames=TTHA0578; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->192|URK_THET8|2e-99|100.0|192/211| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 95->108|rsprrtpvrpapvv| SEG 193->210|alemlaakalarlarmga| BL:PDB:NREP 1 BL:PDB:REP 5->192|1udwA|7e-42|43.1|188/204| RP:PDB:NREP 1 RP:PDB:REP 2->190|1a7jA|1e-25|17.6|187/279| RP:PFM:NREP 1 RP:PFM:REP 8->185|PF00485|2e-34|49.7|177/189|PRK| HM:PFM:NREP 1 HM:PFM:REP 8->191|PF00485|1.5e-42|34.4|183/194|PRK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00485|IPR006083| GO:PFM GO:0008152|"GO:metabolic process"|PF00485|IPR006083| GO:PFM GO:0016301|"GO:kinase activity"|PF00485|IPR006083| RP:SCP:NREP 1 RP:SCP:REP 6->157|1rz3A|4e-34|25.2|151/184|c.37.1.6| HM:SCP:REP 4->199|1esmA_|4.1e-54|40.0|195/311|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 927 OP:NHOMOORG 584 OP:PATTERN -------------------------111--1------------11-111------------------- 1111------------------------------------------------------------------------------------2221-111---111111-1111----------1111------------222-----1-21121111211------11132222------------1111111--1111111111111111111111111111111111111111111111111111111111111111211211111111111111-111111111111111111111111111111111121111111111111-11-11111111111----122121-121----11----2-------1-11----------------------------------1---------------------------211---------------------------------------------------------------------------------------------------------------------1--------------2---------------------------1------------------------------1111--111111111111111111111111-------------1111-111111111111-1111111111111111111111111111111111111111111111111111-111111111111----111111111--1-1111111111111111-----------------------------111111111-11111111111111------------------------111111111-1----1---1--11----1-1--11111-11-1---1-- --11331-31-1--21111-11111----1---111-1111111----11111111-11111222122221121212-2212222211-111111111111-1212-24249958832322233473439S3-546122332332133313-243343248724222622323222343a33344879A1B71111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 91.0 SQ:SECSTR ccTTccEEEEEcccccTHHHHHHHHHHHHHTccEEEEEGGGGccccHHHHHHHHTcTTccTGGGccHHHHHHHHHHHHHHcccEEccccccccccTTcccccEEccccEccTTccccccccGGGccEEEEEEEcHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHTGGGGGTccEEEEEEEccHH################### DISOP:02AL 1-3, 207-211| PSIPRED ccccccEEEEEEccccccHHHHHHHHHHHHcccEEEEEcccEEccccHHHHHHHccccccccccccHHHHHHHHHHHHccccEEEEEEEHHHccccccEEEEccccEEEEEcHHHHccHHHHHHccEEEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccEEHHHHHHHHHHHHHHHHccc //