[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80573.1
DDBJ      :             probable mannitol-binding protein with frameshift
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  163/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->165 2hzlB PDBj 9e-24 32.1 %
:HMM:PFM   2->133 PF03480 * SBP_bac_7 7.4e-23 22.7 128/286  
:HMM:PFM   118->158 PF00827 * Ribosomal_L15e 5.4e-05 26.8 41/192  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80573.1 GT:GENE AAS80573.1 GT:PRODUCT probable mannitol-binding protein with frameshift GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 211845..212357 GB:FROM 211845 GB:TO 212357 GB:DIRECTION + GB:PRODUCT probable mannitol-binding protein with frameshift GB:PROTEIN_ID AAS80573.1 GB:DB_XREF GI:46196155 LENGTH 170 SQ:AASEQ MVPQTLAAGDIYPALERGAIDATEFAGPYDDEKLGFYKVARYYYYPSFWEPSAQLSFLVAQREWARLPKEFQEAFQAAASEVNLTMMAKYDALNPPALRRLLAAGVRLRKWPAEIMRKAEEEARALYEEQAAKDPGYRRVYTAYWAFRDEVFRWFAVAELGYQAFAFPSV GT:EXON 1|1-170:0| SEG 70->79|efqeafqaaa| SEG 92->109|alnppalrrllaagvrlr| BL:PDB:NREP 1 BL:PDB:REP 1->165|2hzlB|9e-24|32.1|165/337| HM:PFM:NREP 2 HM:PFM:REP 2->133|PF03480|7.4e-23|22.7|128/286|SBP_bac_7| HM:PFM:REP 118->158|PF00827|5.4e-05|26.8|41/192|Ribosomal_L15e| OP:NHOMO 232 OP:NHOMOORG 165 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1---------------------1---1111111-----111-11--------1-1-1--11-2-1-----1-------33-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4221121111111111111111-11111111212-233111111111221112121122----------------111-----------------------------------24443------------------------111111---121112132121111----1--------1-211--2-------------------------------1-1---------------11111------213-1-111111-1-1111-1--1-2---1--1--------------------------------------------------------------------------------------------1----------13-5--------------------------1--------4----2------------2---22222211122----------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 97.1 SQ:SECSTR cEEEcccGGGHHHHHHHTcccEEccccHHHHHHHTGGGTccEEEEccTTccccEEEEEEEHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHH##### PSIPRED cccccccHHHHHHHHHHccccccccccHHHHHHccHHHHHcEEEEccccccccEEEEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //