[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80586.1
DDBJ      :             acyl-CoA dehydrogenase, short-chain specific
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  570/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:378 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->371 1ukwA PDBj 8e-73 40.6 %
:RPS:PDB   4->368 3d9fC PDBj 9e-86 20.0 %
:RPS:SCOP  4->222 1rx0A2  e.6.1.1 * 8e-54 31.2 %
:RPS:SCOP  226->378 1siqA1  a.29.3.1 * 5e-40 29.4 %
:HMM:SCOP  4->237 1is2A3 e.6.1.2 * 6e-76 50.7 %
:HMM:SCOP  221->374 2c12A1 a.29.3.1 * 6e-58 57.8 %
:RPS:PFM   5->113 PF02771 * Acyl-CoA_dh_N 4e-11 42.2 %
:RPS:PFM   117->168 PF02770 * Acyl-CoA_dh_M 2e-14 67.3 %
:RPS:PFM   223->371 PF00441 * Acyl-CoA_dh_1 4e-33 56.4 %
:HMM:PFM   223->371 PF00441 * Acyl-CoA_dh_1 2.3e-57 55.0 149/150  
:HMM:PFM   4->113 PF02771 * Acyl-CoA_dh_N 2.1e-32 45.9 109/113  
:HMM:PFM   117->168 PF02770 * Acyl-CoA_dh_M 1.2e-23 61.5 52/52  
:BLT:SWISS 5->371 ACDS_CLOAB 7e-77 40.9 %
:PROS 119->131|PS00072|ACYL_COA_DH_1
:PROS 330->349|PS00073|ACYL_COA_DH_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80586.1 GT:GENE AAS80586.1 GT:PRODUCT acyl-CoA dehydrogenase, short-chain specific GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(225452..226588) GB:FROM 225452 GB:TO 226588 GB:DIRECTION - GB:PRODUCT acyl-CoA dehydrogenase, short-chain specific GB:PROTEIN_ID AAS80586.1 GB:DB_XREF GI:46196168 LENGTH 378 SQ:AASEQ MEVPEHKEIRELARRFLSERGGALRAYEEEEAFPWPLVEEMAELGFLGVFVPEALGGAGLDFFAYLALLEEMGGWASLRSVLSVQQSLVLTPLLAYGTEAQKARYVPRLARGEVLGAFALTEPEAGSDAASLKTRARREGDFYVLEGQKTFISHANVAEVFLVFAKTDPEKGAKGITCFLVERGDGVKTSPLKGKLGLRAADTGMVFLDGVRVPKDRVLGKEGEGFRIALSTLDTGRISLAAGAVGLMQRALDLSLAYAGERKQFGKPIAQFQLVQEHLAAMKLDLEAARLLTYRAAWKKVKGEPYTLEASLAKLFASEAANRVAYRAIQVHGGYGFFEEYEVARLYRDARILTLYEGTSEVQKLIIGAHLTGVRAFA GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 5->371|ACDS_CLOAB|7e-77|40.9|367/379| PROS 119->131|PS00072|ACYL_COA_DH_1|PDOC00070| PROS 330->349|PS00073|ACYL_COA_DH_2|PDOC00070| SEG 77->90|slrsvlsvqqslvl| BL:PDB:NREP 1 BL:PDB:REP 5->371|1ukwA|8e-73|40.6|367/379| RP:PDB:NREP 1 RP:PDB:REP 4->368|3d9fC|9e-86|20.0|365/430| RP:PFM:NREP 3 RP:PFM:REP 5->113|PF02771|4e-11|42.2|109/113|Acyl-CoA_dh_N| RP:PFM:REP 117->168|PF02770|2e-14|67.3|52/53|Acyl-CoA_dh_M| RP:PFM:REP 223->371|PF00441|4e-33|56.4|149/150|Acyl-CoA_dh_1| HM:PFM:NREP 3 HM:PFM:REP 223->371|PF00441|2.3e-57|55.0|149/150|Acyl-CoA_dh_1| HM:PFM:REP 4->113|PF02771|2.1e-32|45.9|109/113|Acyl-CoA_dh_N| HM:PFM:REP 117->168|PF02770|1.2e-23|61.5|52/52|Acyl-CoA_dh_M| GO:PFM:NREP 6 GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02771|IPR006092| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02771|IPR006092| GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02770|IPR006091| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02770|IPR006091| GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| RP:SCP:NREP 2 RP:SCP:REP 4->222|1rx0A2|8e-54|31.2|218/231|e.6.1.1| RP:SCP:REP 226->378|1siqA1|5e-40|29.4|153/154|a.29.3.1| HM:SCP:REP 4->237|1is2A3|6e-76|50.7|225/0|e.6.1.2|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 221->374|2c12A1|6e-58|57.8|154/0|a.29.3.1|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 7863 OP:NHOMOORG 775 OP:PATTERN 55----6899B99A87-243532EA6661-7C-----------------------------5771--- 4557b4-5111846f*vVV-Vt44uxVVVVVeyz*zex**4lAs1144-11-677669--LJb1HLVQKRG--------384B-----11111122---41545664565--------------------------676AA---C312-1111--------------122-------------89978--1F745555545555555553555545557DB9A11------54-111111-11111111---1--1------------------------------------------------------------------111315444444444423222221-6-316-13-B91599-17---11-3-71-TLLZ-----43ZNR665UHURMAA9A9AA7978-44C44G4CCBb-777775777878AHAVCADF7777D9J11111111C----9C6-----------------------------1PPbO18WLDSEEGLSFDCIIGDDPHLLLLDKXEcbzwp35IJDD7FIIRHKNTf33A----66-------212I984jHK-----------765-B-5--8898FD66----1-------1--------1-----54-AG498HD1676666AF6666B6E8688---221-------42731214445455444-444444443444444444322211112544245544353533522333233--222232212232---6222228888-LE43---------------JJKGJDI8AA91PPQRAMFJKFDGFH969111111111-111422222462447766666566------12CC98CC----------1-------------------------1--11-1------ ----CAA-941-AAAEDCCE9AAB8ACCC9AAB988AA9A9AABDDA87899BF8A7867774-1-1--1--1-1------11111---8B8D8976666A99DCD-D7BJEWCBFE99AAAEAKC7I9Y*G-FES8B96F8BJB4BB88D84JAECBQAGI7LCF9D9DDFLHI3364j43365867KB4665GAA9A ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHHHHTTcccHHHHHHTTHHHHHHHHHTTTTGGGccGGGTcccccHHHHHHHHHHHHTTccTTHHHHHHHHHHHHHHHHcccHHHHHHHcHHHHcccccEEEEcccTTccTTccccccEEEEETTEEEEEEEEEccTTTTTccEEEEEEEEccccGGGGEEEEEEcHHGGEEEEEcccccccTTccccEEEEEEEEEEGGGccccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTcccGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcGGGGcTTccHHHHHHHHTTTTTccccTTTHHHHHHHHHHHccccH PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccEEEEEEcccccccccHHHcEEEEEEEccEEEEEEEEEEEEccccccEEEEEEEcccccccccEEEEEEEccccEEEccccccccccccccEEEEEccEEccHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccc //