[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80610.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->50 PF02416 * MttA_Hcf106 4.6e-21 52.1 48/53  
:BLT:SWISS 1->50 TATA_COREF 3e-07 64.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80610.1 GT:GENE AAS80610.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 253757..253918 GB:FROM 253757 GB:TO 253918 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80610.1 GB:DB_XREF GI:46196192 LENGTH 53 SQ:AASEQ MNLGPMEIILILLIVLLLFGAKKLPELARGIGQAAREFRKGIQEEEKKEEPKA GT:EXON 1|1-53:0| BL:SWS:NREP 1 BL:SWS:REP 1->50|TATA_COREF|3e-07|64.0|50/103| TM:NTM 1 TM:REGION 7->29| SEG 8->18|iilillivlll| HM:PFM:NREP 1 HM:PFM:REP 3->50|PF02416|4.6e-21|52.1|48/53|MttA_Hcf106| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 35-53| PSIPRED ccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //