[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80614.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->79 1j0lA PDBj 7e-05 37.3 %
:RPS:PDB   29->80 2dviA PDBj 5e-06 17.3 %
:RPS:SCOP  10->112 1no5A  d.218.1.5 * 3e-08 19.6 %
:HMM:SCOP  1->124 1knyA2 d.218.1.1 * 1.4e-16 35.0 %
:RPS:PFM   29->59 PF01909 * NTP_transf_2 2e-04 58.1 %
:HMM:PFM   17->60 PF01909 * NTP_transf_2 1.3e-12 40.9 44/93  
:BLT:SWISS 14->44 Y1235_METTH 2e-04 58.1 %
:BLT:SWISS 28->116 Y1305_METJA 2e-05 29.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80614.1 GT:GENE AAS80614.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(256826..257194) GB:FROM 256826 GB:TO 257194 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80614.1 GB:DB_XREF GI:46196196 LENGTH 122 SQ:AASEQ MTRVFRFDPKARLKEVAEAARALGERPEVLAVVLFGSLARGEATAFSDADLLVLLRETPLPFPERLVRYRPEGVRRVEVFPYTLSEALEGLKGGFGVVPAALREGRVLFEREGAWEALRRLA GT:EXON 1|1-122:0| BL:SWS:NREP 2 BL:SWS:REP 14->44|Y1235_METTH|2e-04|58.1|31/218| BL:SWS:REP 28->116|Y1305_METJA|2e-05|29.1|86/147| BL:PDB:NREP 1 BL:PDB:REP 13->79|1j0lA|7e-05|37.3|67/98| RP:PDB:NREP 1 RP:PDB:REP 29->80|2dviA|5e-06|17.3|52/431| RP:PFM:NREP 1 RP:PFM:REP 29->59|PF01909|2e-04|58.1|31/104|NTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 17->60|PF01909|1.3e-12|40.9|44/93|NTP_transf_2| GO:PFM:NREP 1 GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01909|IPR002934| RP:SCP:NREP 1 RP:SCP:REP 10->112|1no5A|3e-08|19.6|97/100|d.218.1.5| HM:SCP:REP 1->124|1knyA2|1.4e-16|35.0|120/0|d.218.1.1|1/1|Nucleotidyltransferase| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------12------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 55.7 SQ:SECSTR ############HHHHHHHHHHHHHHHTTccEEEEHHHHHTcccTccEEEEEEEEcTTccHHHHHHHHHHHHHHHccEEE########################################## DISOP:02AL 1-2| PSIPRED ccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccccccEEEEEEEccccccHHHHHHHHccccccEEEEEEEcHHHHHHHHHcccccHHHHHHccEEEEccccHHHHHHccc //