[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80622.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:316 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->51 PF02706 * Wzz 0.00017 26.5 49/152  
:BLT:SWISS 53->115 FA5_BOVIN 1e-06 47.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80622.1 GT:GENE AAS80622.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(263044..263994) GB:FROM 263044 GB:TO 263994 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80622.1 GB:DB_XREF GI:46196204 LENGTH 316 SQ:AASEQ MENEVTLLDLLWALRRAFLRLLLLALGVGLGVYALSLLLPKRYESAALLWLDLRPFPSQEALRPFPSQEALRPFPSQEALSPDQPLTSPPLASLVQALDLSLPTLRLSPAGEPASRFAQVEWDAKAQVLSLRAFGATPEEAQRRATKLLEEARSFLQARVREAYGGLAAAELARAEKALGLLEKALQEEVPQVSSRGSADLAPFLEAQGTPPPVARAQDPAATYLALKRAELLAEASRLQAQVAWLRDLLAQDGTWDRFLAESVLLSPTLPERPLAPRPLAYGVLAALGALLLGVLWVFLATVLRPGGAGVPQSDA GT:EXON 1|1-316:0| BL:SWS:NREP 1 BL:SWS:REP 53->115|FA5_BOVIN|1e-06|47.6|63/100| TM:NTM 2 TM:REGION 19->40| TM:REGION 282->304| SEG 5->39|vtlldllwalrraflrllllalgvglgvyalslll| SEG 162->189|eaygglaaaelaraekalgllekalqee| SEG 225->242|lalkraellaeasrlqaq| SEG 268->301|ptlperplaprplaygvlaalgalllgvlwvfla| HM:PFM:NREP 1 HM:PFM:REP 3->51|PF02706|0.00017|26.5|49/152|Wzz| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 80-85, 106-114, 133-147, 191-195, 310-316| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccHHcccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //