[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80631.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:418 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80631.1 GT:GENE AAS80631.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(273094..274350) GB:FROM 273094 GB:TO 274350 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80631.1 GB:DB_XREF GI:46196213 LENGTH 418 SQ:AASEQ MRFLWHRISSSPFLKGVLAIGGGTALAQALGVAVTPILTRLYDPTAMALWGLFVSFVSVASVAVTLRYEVAVVAAKKREEAGALVLGALALSLVLSLVGGIVFEILRRNNWLGYGLFPEWASWLAVLALVGTNWGLILRYWATREGLFSLVGKFAIWQALGRALGQLSLALLGGSGLVLGETLGRWWGLAALWRNWVTRGPKLWNPAVLWQYRTYPLVQFPSSLLDTLALMALVPVFTAVYGTQIGGGLALTQRLVNFPLTLIGGAVADVFYSRAAALLRDQPASLPVLFWGTARYLLILAASLGLLVGLALPPLVTWLFGADWGSVERMMQAMALWMSAMLVVSPLSRLIFLSRWSWIKLIYDLISLVVVALPLWYHLEGAYQALQTVSWLKTLQLVLYFGLLTFVLAKLADTKGEK GT:EXON 1|1-418:0| TM:NTM 10 TM:REGION 15->37| TM:REGION 50->72| TM:REGION 83->105| TM:REGION 128->150| TM:REGION 165->187| TM:REGION 218->240| TM:REGION 294->316| TM:REGION 331->353| TM:REGION 358->380| TM:REGION 392->414| SEG 53->64|fvsfvsvasvav| SEG 69->100|evavvaakkreeagalvlgalalslvlslvgg| SEG 159->184|algralgqlslallggsglvlgetlg| SEG 297->316|llilaaslgllvglalpplv| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------------------------------1---11-------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 415-418| PSIPRED cccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHccHHHcEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //