[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80632.1
DDBJ      :             pleiotropic regulatory protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  634/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:371 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->368 2ogaC PDBj 3e-82 46.6 %
:RPS:PDB   9->370 3dr4C PDBj 6e-52 39.7 %
:RPS:SCOP  27->370 1o61A  c.67.1.4 * 3e-98 27.8 %
:HMM:SCOP  8->373 1b9hA_ c.67.1.4 * 3.2e-120 47.9 %
:RPS:PFM   31->355 PF01041 * DegT_DnrJ_EryC1 3e-91 54.9 %
:HMM:PFM   27->362 PF01041 * DegT_DnrJ_EryC1 5.5e-137 55.3 333/363  
:BLT:SWISS 12->368 DEGT_BACST 5e-91 52.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80632.1 GT:GENE AAS80632.1 GT:PRODUCT pleiotropic regulatory protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(274347..275462) GB:FROM 274347 GB:TO 275462 GB:DIRECTION - GB:PRODUCT pleiotropic regulatory protein GB:PROTEIN_ID AAS80632.1 GB:DB_XREF GI:46196214 LENGTH 371 SQ:AASEQ MNSNGYHSMKAIPVYDPLPEVEALWPELEEAFRRVMHSGQYILGPEVEAFEQEVAAYLGVKYAIGVNSGTDALVIALRALGVGPGDEVITTPFTFFATAEAISAVGATPVFVDIDPKTFNINPDLIAPAITPRTKAILPVHLYGLPADMDTILEIARSHGLKVLEDCAQAFGATYKGRKVGTLGDAGAFSFFPTKNLGGYGDGGLIATNSDEVAEMARMLRAHGSRRKYHNEMVGYNSRLDALQAAFLRVKLKHVDAFNARRREVAARYNDLLQGVPGLVLPPLTEGHVFHQYTVRIPVGRDQVAEELASKGIGTMVYYPVPLHRLPVYGYPEGTFPEAERASREVLSLPMGPFLGPQNEHVASLLREILA GT:EXON 1|1-371:0| BL:SWS:NREP 1 BL:SWS:REP 12->368|DEGT_BACST|5e-91|52.5|356/372| SEG 90->101|ttpftffataea| SEG 272->284|llqgvpglvlppl| BL:PDB:NREP 1 BL:PDB:REP 12->368|2ogaC|3e-82|46.6|356/369| RP:PDB:NREP 1 RP:PDB:REP 9->370|3dr4C|6e-52|39.7|355/368| RP:PFM:NREP 1 RP:PFM:REP 31->355|PF01041|3e-91|54.9|324/358|DegT_DnrJ_EryC1| HM:PFM:NREP 1 HM:PFM:REP 27->362|PF01041|5.5e-137|55.3|333/363|DegT_DnrJ_EryC1| RP:SCP:NREP 1 RP:SCP:REP 27->370|1o61A|3e-98|27.8|338/374|c.67.1.4| HM:SCP:REP 8->373|1b9hA_|3.2e-120|47.9|357/0|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 1707 OP:NHOMOORG 697 OP:PATTERN -----1--1-------1311111----2-2--222-1211--112-1414-11111-1-12---1-12 266-5---11----1--11-1---2-1-111-----22112335-41-----223-----6231635215---------231-113419433-711---43445334717--------------23233222344145575---2-4431444122222121214213364422222234122---1-222--4--1-111--1-1-3---4443-1312-1211------22---------------2--1-------------1-----1-----------------11111111111-----------------------111353334444533--33311--3412-121332334311-1--21---221433311111115424322112322222222221-21221415321-----3425453133122222--222421111111121112A12-----------------------------23-11-333233334322333311235555353243233124326233-23132212411217311111111-21213425424435665448449538532333135355531443453131111111441342241-112223113223251222222332143---2222------23232322332222322-32222222323223323322225876232333333332333322211222321233333323333--1-444442222311-31112-21----2--1-1111111311-212125521--222322211111111342111111112-131123333223------73667779--------211-------------------------2233322222251 -------------1-------11212-------111--------------1---------------------------------------------------------2-2-----------------------------------------------1---121--------11---3F--2-----1---2-2-113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 371 STR:RPRED 100.0 SQ:SECSTR HHHHHTcccccccccccccccccccccHHHHHHHHHHHTccccccHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHHTTccTTcEEEEEccccTHHHHHHHHTTcEEEEEcccTTTccccHHHHGGGccTTEEEEccccGGGccccHHHHHHHHHHTTcEEEEEcTTcTTcEETTEETTccccEEEEEccTTcTcccccccEEEEEccHHHHHHHHHHHcTTTTcTTccccccccccccHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHGGGGGGGEEcccccccccccEEEEEcccHHHHHHHHHHTTcccEEcccHcGGGcGGGGGcccccHHHHHHHHHEEEEcccTTccHHHHHHHHHHHHHcH DISOP:02AL 1-7| PSIPRED ccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHcccEEEEEccHHcccccccEEEcccccEEEEEEccccccccccccEEEEEccHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEEEEEcccHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHcEEEccccccccHHHHHHHHHHHHHHc //