[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80640.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->72 PF01442 * Apolipoprotein 6.3e-05 22.4 58/202  
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80640.1 GT:GENE AAS80640.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 282019..282285 GB:FROM 282019 GB:TO 282285 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80640.1 GB:DB_XREF GI:46196223 LENGTH 88 SQ:AASEQ MPEDHLLERLEKLEGIVETTVRVLPPLVRDLSRRIDGLREEMQGVAARLEARIQQAEAKLEGQIQWVRSELEGFTLIGVALAPLSLLR GT:EXON 1|1-88:0| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 32->63| HM:PFM:NREP 1 HM:PFM:REP 12->72|PF01442|6.3e-05|22.4|58/202|Apolipoprotein| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //