[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80644.1
DDBJ      :             probable transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->66 1xnpB PDBj 7e-09 45.3 %
:RPS:PDB   7->64 1bibA PDBj 6e-09 24.1 %
:RPS:SCOP  10->67 2hoeA1  a.4.5.63 * 1e-06 25.9 %
:HMM:SCOP  5->192 2p4wA1 a.4.5.64 * 1.4e-21 34.7 %
:RPS:PFM   1->64 PF01978 * TrmB 7e-04 40.0 %
:HMM:PFM   13->72 PF01978 * TrmB 7.9e-12 41.5 53/68  
:BLT:SWISS 7->61 LEXA_MAGSM 3e-04 37.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80644.1 GT:GENE AAS80644.1 GT:PRODUCT probable transcriptional regulator GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 284517..285119 GB:FROM 284517 GB:TO 285119 GB:DIRECTION + GB:PRODUCT probable transcriptional regulator GB:PROTEIN_ID AAS80644.1 GB:DB_XREF GI:46196227 LENGTH 200 SQ:AASEQ MVLLEGTKERVLELLRARPRTAKEVAEALGVSRTAAQKHLQDLEERGLAASEVRKCPGRGRPYRVWRALDPEAPYAALCGDVLKGLEAALGREGVVRVLLERNRALLAPLGLEGLPVRARLERLAAFLRERGYEAEVVEEEGALYLCQRRCPKLALSKEHEALCESELLAYEEALGLPLAREERIAEGGRCCRYRVKPVS GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 7->61|LEXA_MAGSM|3e-04|37.3|51/231| SEG 105->116|allaplgleglp| SEG 118->146|rarlerlaaflrergyeaevveeegalyl| BL:PDB:NREP 1 BL:PDB:REP 2->66|1xnpB|7e-09|45.3|64/194| RP:PDB:NREP 1 RP:PDB:REP 7->64|1bibA|6e-09|24.1|54/294| RP:PFM:NREP 1 RP:PFM:REP 1->64|PF01978|7e-04|40.0|60/63|TrmB| HM:PFM:NREP 1 HM:PFM:REP 13->72|PF01978|7.9e-12|41.5|53/68|TrmB| RP:SCP:NREP 1 RP:SCP:REP 10->67|2hoeA1|1e-06|25.9|54/58|a.4.5.63| HM:SCP:REP 5->192|2p4wA1|1.4e-21|34.7|176/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 45.0 SQ:SECSTR cccccHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTccTccccEEETTTEEEcGTEccHHHHEEHHHHHHHHHHHHHcT############################################################################################################## DISOP:02AL 3-4, 110-111, 113-114| PSIPRED cccccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccEEEEEcccEEEEEEcccHHHHHHHHcHHHHHHHHHHHHHHHcccEEHHHHHHcccccccEEEEEcc //