[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80650.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:399 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->384 1pw4A_ f.38.1.1 * 4.3e-48 41.1 %
:HMM:PFM   9->335 PF07690 * MFS_1 1.8e-36 37.7 326/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80650.1 GT:GENE AAS80650.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(288794..289993) GB:FROM 288794 GB:TO 289993 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80650.1 GB:DB_XREF GI:46196233 LENGTH 399 SQ:AASEQ MDRRLLALLSGVLLGTVSESSLAPALPVLERAFAVGPEAAQGVVSLGLLGAALAYLPLAGLAGRVGAGRLFRTGLFLHALSALLLALAPSLLALYLLRLLQGVATAMVVGLVPGLAASAFPEARGYALGMVASTVAAGTLLGPALGGLAAGWGLPYVFLLPLPAALLALLLSGNLPELPRQEGTLPGLLRAPGFLPALLATGLYFLHALGTTVALAFHLGKEGFSPGAIGGLLLLGPLELLFLGAWAGRRADRMGYNRVALLGAYLLVAAGLAFALLPLLHPLWGSALALLLLGVGRALFQAANNALVLSLAPKGTEGLASGALSVARALGQALGSALAGGSLGLFYRLFPSHGLAFAATALLLTALMGLAAFLVRGREGSGEEVGHAPLDDPGGEGGA GT:EXON 1|1-399:0| TM:NTM 12 TM:REGION 5->27| TM:REGION 42->64| TM:REGION 73->95| TM:REGION 100->122| TM:REGION 127->149| TM:REGION 155->177| TM:REGION 191->213| TM:REGION 225->247| TM:REGION 258->280| TM:REGION 290->312| TM:REGION 329->351| TM:REGION 354->376| SEG 5->22|llallsgvllgtvsessl| SEG 39->72|aaqgvvslgllgaalaylplaglagrvgagrlfr| SEG 75->100|lflhalsalllalapsllalyllrll| SEG 136->179|aagtllgpalgglaagwglpyvfllplpaallalllsgnlpelp| SEG 230->244|ggllllgplellflg| SEG 260->299|allgayllvaaglafallpllhplwgsalallllgvgral| SEG 327->345|aralgqalgsalaggslgl| SEG 354->386|glafaatallltalmglaaflvrgregsgeevg| HM:PFM:NREP 1 HM:PFM:REP 9->335|PF07690|1.8e-36|37.7|326/353|MFS_1| HM:SCP:REP 1->384|1pw4A_|4.3e-48|41.1|375/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 379-399| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //